DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mkp3 and dusp13a

DIOPT Version :9

Sequence 1:NP_001262031.1 Gene:Mkp3 / 40081 FlyBaseID:FBgn0036844 Length:497 Species:Drosophila melanogaster
Sequence 2:NP_001103865.1 Gene:dusp13a / 568887 ZFINID:ZDB-GENE-080204-69 Length:189 Species:Danio rerio


Alignment Length:139 Identity:43/139 - (30%)
Similarity:68/139 - (48%) Gaps:6/139 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   223 LFLGNATHSCDSEALKKYNIKYVLNVTPDLPN-----KFKESGDIKYLQIPITDHYSQDLAIHFP 282
            :::||...:.|...|....|.:::|.....|:     :|....:|.|..:...|.:...::..|.
Zfish    39 VYIGNEVAARDKPMLYNMGITHIVNAASGPPHVNTGPRFYRDMNIDYYGVEADDSFDFAISGFFY 103

  Fly   283 DAIQFIEEARSASSVVLVHCLAGVSRSVTVTLAYLMHTRGLSLNDAFAMVRDRKPDVSPNFHFMQ 347
            ...:||..|.|.:..|.||||.|||||.|:.||:||....|:|.:|...||..: |:.||..|:.
Zfish   104 ATARFIRAALSKNGRVFVHCLMGVSRSATLVLAFLMICEDLTLMEAIKAVRQHR-DICPNPGFLN 167

  Fly   348 QLLSFESQL 356
            ||...:.:|
Zfish   168 QLRHLDMRL 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mkp3NP_001262031.1 DSP_MapKP 8..148 CDD:238723
DSPc 215..353 CDD:238073 42/134 (31%)
CDC14 <242..359 CDD:225297 39/120 (33%)
dusp13aNP_001103865.1 DSPc 31..173 CDD:238073 42/134 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.