DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mkp3 and si:ch211-195b15.8

DIOPT Version :9

Sequence 1:NP_001262031.1 Gene:Mkp3 / 40081 FlyBaseID:FBgn0036844 Length:497 Species:Drosophila melanogaster
Sequence 2:XP_686342.1 Gene:si:ch211-195b15.8 / 558079 ZFINID:ZDB-GENE-131127-627 Length:462 Species:Danio rerio


Alignment Length:336 Identity:89/336 - (26%)
Similarity:138/336 - (41%) Gaps:85/336 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   215 PVEIIPGLLFLGNATHSCDSEALKKYNIKYVLNVT---PDLPNKFKESGDIKYLQIPITDHYSQD 276
            |:..|...|:||..| ....:.|....|.|||:|:   |. |:...:|   :||:|||.|....|
Zfish    13 PLSRILPHLYLGAET-DVTQDGLSDRGISYVLSVSRCCPQ-PSFLPQS---QYLRIPIDDSLRDD 72

  Fly   277 LAIHFPDAIQFIEEARSASSVVLVHCLAGVSRSVTVTLAYLMHTRGLSLNDAFAMVRDRKPDVSP 341
            |....|.|:.||:.|.||...|||||.||:|||..:.:||:|::..:.|:.|:..|::|:|.:||
Zfish    73 LLPWIPQALHFIDGAMSAGCSVLVHCAAGISRSPALAVAYVMYSLKMDLDHAYRFVKERRPTISP 137

  Fly   342 NFHFMQQLLSFESQLRLR--------------PGS-RFSCSCIAP-----------DCNCM---Q 377
            ||:|:.||..|:..|.|:              |.| :.:.|..||           |.||:   :
Zfish   138 NFNFLGQLQLFQGTLSLKNNKSNLHALDNCPQPTSEKHNSSSTAPLLTNLNLQNNMDNNCIINGR 202

  Fly   378 TTGFMAT-HLANATG--------------VSPD----------------SGIEFDRWTPSDTGLK 411
            |....|. |..|...              :.|:                :..|..|  |::...:
Zfish   203 TEDSKANMHCENKNSQQENVQSRGQDYKLLKPEFTLSLSDKLSALTLRTNPAEVQR--PANVTSQ 265

  Fly   412 XEQSGGKSFVLPPSQ-EVPFAAAATSPLPMCL--------------AVNPDNMSPASTTSSSTST 461
            .:|...||.:..|:. ::|..|.....|.:.|              :||..::..:|.......|
Zfish   266 TQQDAPKSILAKPTHLQIPSLAEKRKSLTLSLTPASAVPQTPQKGSSVNSCDLKQSSPAGDQKGT 330

  Fly   462 TTTAEAVSVVE 472
            ......||.:|
Zfish   331 LDDRSRVSALE 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mkp3NP_001262031.1 DSP_MapKP 8..148 CDD:238723
DSPc 215..353 CDD:238073 55/140 (39%)
CDC14 <242..359 CDD:225297 50/119 (42%)
si:ch211-195b15.8XP_686342.1 DSPc 13..149 CDD:238073 55/140 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D389486at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.