Sequence 1: | NP_001262031.1 | Gene: | Mkp3 / 40081 | FlyBaseID: | FBgn0036844 | Length: | 497 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_686342.1 | Gene: | si:ch211-195b15.8 / 558079 | ZFINID: | ZDB-GENE-131127-627 | Length: | 462 | Species: | Danio rerio |
Alignment Length: | 336 | Identity: | 89/336 - (26%) |
---|---|---|---|
Similarity: | 138/336 - (41%) | Gaps: | 85/336 - (25%) |
- Green bases have known domain annotations that are detailed below.
Fly 215 PVEIIPGLLFLGNATHSCDSEALKKYNIKYVLNVT---PDLPNKFKESGDIKYLQIPITDHYSQD 276
Fly 277 LAIHFPDAIQFIEEARSASSVVLVHCLAGVSRSVTVTLAYLMHTRGLSLNDAFAMVRDRKPDVSP 341
Fly 342 NFHFMQQLLSFESQLRLR--------------PGS-RFSCSCIAP-----------DCNCM---Q 377
Fly 378 TTGFMAT-HLANATG--------------VSPD----------------SGIEFDRWTPSDTGLK 411
Fly 412 XEQSGGKSFVLPPSQ-EVPFAAAATSPLPMCL--------------AVNPDNMSPASTTSSSTST 461
Fly 462 TTTAEAVSVVE 472 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Mkp3 | NP_001262031.1 | DSP_MapKP | 8..148 | CDD:238723 | |
DSPc | 215..353 | CDD:238073 | 55/140 (39%) | ||
CDC14 | <242..359 | CDD:225297 | 50/119 (42%) | ||
si:ch211-195b15.8 | XP_686342.1 | DSPc | 13..149 | CDD:238073 | 55/140 (39%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D389486at33208 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.920 |