DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mkp3 and styx

DIOPT Version :10

Sequence 1:NP_001262031.1 Gene:Mkp3 / 40081 FlyBaseID:FBgn0036844 Length:497 Species:Drosophila melanogaster
Sequence 2:NP_001019561.1 Gene:styx / 554088 ZFINID:ZDB-GENE-050522-45 Length:224 Species:Danio rerio


Alignment Length:197 Identity:61/197 - (30%)
Similarity:92/197 - (46%) Gaps:43/197 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   217 EIIPGLLFLG--NATHSCDSEALKKYNIKYVLNV---------TPDLPNKFKESGDIKYLQIPIT 270
            ||:|| ||||  :|........|:|..|.:::.|         .|:.|:||      :||.:.|.
Zfish    32 EILPG-LFLGPYSAAMKSKLSMLEKQGITHIVCVRQDIEANFIKPNFPHKF------RYLVLDIA 89

  Fly   271 DHYSQDLAIHFPDAIQFIEEARSASSVVLVHCLAGVSRSVTVTLAYLMHTRGLSLNDAFAMVRDR 335
            |:..:::..:||...:||:........||||..||:|||..:.:||||.|.|:...|||:.|::|
Zfish    90 DNPVENIIRYFPTTKEFIDGCLETGGKVLVHGNAGISRSAALVIAYLMETFGVKYRDAFSHVQER 154

  Fly   336 KPDVSPNFHFMQQLLSFE------------SQLRLRPGSRFSCSCIAP-----------DCNCMQ 377
            :..::||..|:.||..:|            |.::|  |..||.....|           |...||
Zfish   155 RFCINPNVGFVHQLQEYEAIYLAKLTIKMMSPIQL--GRSFSIQAGMPGSLKRTLEEDEDFGSMQ 217

  Fly   378 TT 379
            .|
Zfish   218 VT 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mkp3NP_001262031.1 DSP_MapKP 8..148 CDD:238723
DSP_MKP_classII 215..352 CDD:350414 50/145 (34%)
styxNP_001019561.1 DSP_STYX 26..176 CDD:350372 51/150 (34%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.