DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mkp3 and SSH3

DIOPT Version :9

Sequence 1:NP_001262031.1 Gene:Mkp3 / 40081 FlyBaseID:FBgn0036844 Length:497 Species:Drosophila melanogaster
Sequence 2:NP_060327.3 Gene:SSH3 / 54961 HGNCID:30581 Length:659 Species:Homo sapiens


Alignment Length:265 Identity:67/265 - (25%)
Similarity:107/265 - (40%) Gaps:32/265 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   223 LFLGNATHSCDSEALKKYNIKYVLNVTPDLPNKFKESGDIKYLQIPITDHYSQDLAIHFPDAIQF 287
            |:||:..::.:.|.|::..:.::||:..::.|.:.|.  ..|..:.:.|..|..|..|:.:..:|
Human   336 LYLGSEWNAANLEELQRNRVTHILNMAREIDNFYPER--FTYHNVRLWDEESAQLLPHWKETHRF 398

  Fly   288 IEEARSASSVVLVHCLAGVSRSVTVTLAYLMHTRGLSLNDAFAMVRDRKPDVSPNFHFMQQLLSF 352
            ||.||:..:.|||||..|||||....|||.|.....||..|...|::.:|...||..|::||..:
Human   399 IEAARAQGTHVLVHCKMGVSRSAATVLAYAMKQYECSLEQALRHVQELRPIARPNPGFLRQLQIY 463

  Fly   353 ESQLRLRPGSRFSCSCIAPDCNCMQTTGFMATHL--ANATGVSPDSGIEFDRWTPSDTGLKXEQS 415
            :..|                      |....:|:  ....||||:.....:..||........:.
Human   464 QGIL----------------------TASRQSHVWEQKVGGVSPEEHPAPEVSTPFPPLPPEPEG 506

  Fly   416 GGKSFV--LPPSQEVPFAAAATSPLPMCLAVNPDNMSPASTTSSSTSTTTTAEAVSVVEMVQHRD 478
            ||:..|  :..||..|.......|......|    |...|....|....:|:|...:.|:....:
Human   507 GGEEKVVGMEESQAAPKEEPGPRPRINLRGV----MRSISLLEPSLELESTSETSDMPEVFSSHE 567

  Fly   479 QEMAE 483
            ....|
Human   568 SSHEE 572

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mkp3NP_001262031.1 DSP_MapKP 8..148 CDD:238723
DSPc 215..353 CDD:238073 43/129 (33%)
CDC14 <242..359 CDD:225297 39/116 (34%)
SSH3NP_060327.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..31
SSH-N 3..259 CDD:212166
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 46..96
DEK_C 272..320 CDD:285919
DSPc 329..464 CDD:238073 43/129 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 482..534 13/51 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 547..603 5/26 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 617..638
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2281
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.