DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mkp3 and Dusp3

DIOPT Version :10

Sequence 1:NP_001262031.1 Gene:Mkp3 / 40081 FlyBaseID:FBgn0036844 Length:497 Species:Drosophila melanogaster
Sequence 2:XP_006247464.1 Gene:Dusp3 / 498003 RGDID:1560049 Length:212 Species:Rattus norvegicus


Alignment Length:149 Identity:48/149 - (32%)
Similarity:79/149 - (53%) Gaps:12/149 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   217 EIIPGLLFLGNATHSCDSEALKKYNIKYVLNVTP--------DLPNKFKESGDIKYLQIPITDHY 273
            |:|| .:::|||:.:.|...|:|..|.:|||...        ...:.:|::| |.|:.|...|..
  Rat    58 EVIP-RVYVGNASVAQDITQLQKLGITHVLNAAEGRSFMHVNTSASFYKDTG-ITYMGIKANDTQ 120

  Fly   274 SQDLAIHFPDAIQFIEEARS-ASSVVLVHCLAGVSRSVTVTLAYLMHTRGLSLNDAFAMVRDRKP 337
            ..:|:.:|..|..||::|.: .:..|||||..|.|||.|:.:||||..:.:.:..|.:.||..: 
  Rat   121 EFNLSAYFERAADFIDQALAHKNGRVLVHCREGYSRSPTLVIAYLMLRQKMDVRSALSTVRQNR- 184

  Fly   338 DVSPNFHFMQQLLSFESQL 356
            ::.||..|:.||.....:|
  Rat   185 EIGPNDGFLAQLCQLNDRL 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mkp3NP_001262031.1 DSP_MapKP 8..148 CDD:238723
DSP_MKP_classII 215..352 CDD:350414 47/143 (33%)
Dusp3XP_006247464.1 DUSP3 36..203 CDD:350427 47/147 (32%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.