DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mkp3 and CG15528

DIOPT Version :9

Sequence 1:NP_001262031.1 Gene:Mkp3 / 40081 FlyBaseID:FBgn0036844 Length:497 Species:Drosophila melanogaster
Sequence 2:NP_651767.2 Gene:CG15528 / 43575 FlyBaseID:FBgn0039742 Length:227 Species:Drosophila melanogaster


Alignment Length:141 Identity:56/141 - (39%)
Similarity:77/141 - (54%) Gaps:3/141 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   218 IIPGLLFLGNATHSCDSEALKKYNIKYVLNVTPDLPN-KFKESGDIKYLQIPITDHYSQDLAIHF 281
            |.|.|:..|.|  :.....:.|..:..|:||.|:||: ......:..||:|...|....|||.||
  Fly    47 ITPSLILCGAA--AVVPAYMDKLGVSCVINVAPELPDTPLPSQKNPLYLRIMAQDRSEVDLAKHF 109

  Fly   282 PDAIQFIEEARSASSVVLVHCLAGVSRSVTVTLAYLMHTRGLSLNDAFAMVRDRKPDVSPNFHFM 346
            .:|...|||...:....|:||:||||||.::.|||||...|:||.:|:..|:..:|.|.||..|.
  Fly   110 DEAADLIEEVHLSGGCTLIHCVAGVSRSASLCLAYLMKHAGMSLREAYKHVQAIRPQVRPNSGFF 174

  Fly   347 QQLLSFESQLR 357
            |||..:|.|||
  Fly   175 QQLRRYEQQLR 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mkp3NP_001262031.1 DSP_MapKP 8..148 CDD:238723
DSPc 215..353 CDD:238073 52/135 (39%)
CDC14 <242..359 CDD:225297 50/117 (43%)
CG15528NP_651767.2 DSPc 43..181 CDD:238073 52/135 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462501
Domainoid 1 1.000 44 1.000 Domainoid score I728
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm9172
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2281
SonicParanoid 00.000 Not matched by this tool.
54.870

Return to query results.
Submit another query.