Sequence 1: | NP_001262031.1 | Gene: | Mkp3 / 40081 | FlyBaseID: | FBgn0036844 | Length: | 497 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_036014638.1 | Gene: | Dupd1 / 435391 | MGIID: | 3647127 | Length: | 226 | Species: | Mus musculus |
Alignment Length: | 214 | Identity: | 58/214 - (27%) |
---|---|---|---|
Similarity: | 88/214 - (41%) | Gaps: | 51/214 - (23%) |
- Green bases have known domain annotations that are detailed below.
Fly 185 SACSSSAESSDCESSSHHHH-----------------------------------HHSHHNYNEA 214
Fly 215 PVEIIPGLLFLGNATHSCDSEALKKYNIKYVLNVTPDL------PNKFKESGDIKYLQIPITDHY 273
Fly 274 SQDLAIHFPDAIQFIEEA-RSASSVVLVHCLAGVSRSVTVTLAYLMHTRGLSLNDAFAMVRDRKP 337
Fly 338 DVSPNFHFMQQLLSFESQL 356 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Mkp3 | NP_001262031.1 | DSP_MapKP | 8..148 | CDD:238723 | |
DSPc | 215..353 | CDD:238073 | 48/144 (33%) | ||
CDC14 | <242..359 | CDD:225297 | 43/122 (35%) | ||
Dupd1 | XP_036014638.1 | DUPD1 | 55..214 | CDD:350423 | 52/165 (32%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |