DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mkp3 and CG10089

DIOPT Version :9

Sequence 1:NP_001262031.1 Gene:Mkp3 / 40081 FlyBaseID:FBgn0036844 Length:497 Species:Drosophila melanogaster
Sequence 2:NP_001261803.1 Gene:CG10089 / 39517 FlyBaseID:FBgn0036369 Length:447 Species:Drosophila melanogaster


Alignment Length:307 Identity:80/307 - (26%)
Similarity:122/307 - (39%) Gaps:68/307 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   217 EIIPGLLFLGNATHSCDSEALKKYNIKYVLNVTPDLPNKFKESGDIKYLQIPITDHYSQDLAIHF 281
            :::|| |::||...|.|...|:::.|.:::.: .|.|.:...  |..||.:..:|...|:|:.:|
  Fly     7 KVLPG-LYVGNYRDSKDHAQLERFKISHIIAI-HDSPRRLLP--DKHYLCVMASDTPDQNLSQYF 67

  Fly   282 PDAIQFIEEARSASSVVLVHCLAGVSRSVTVTLAYLMHTRGLSLNDAFAMVRDRKPDVSPNFHFM 346
            .....||..||.....||:|||||:||||||.:||:|....|:..:|..:||..:...:||..|.
  Fly    68 SVCNDFIHAARLREGNVLIHCLAGMSRSVTVAVAYIMTATHLNWKEALKVVRAGRAVANPNAGFQ 132

  Fly   347 QQLLSFE----SQLRLRPGSRF--------------------------------SCS----CIAP 371
            .||..||    |:.|.|...||                                :||    |...
  Fly   133 SQLQEFEQFKLSEERRRLRERFPSSALEQLDRTKVATALDNYQELLQNRDICEGNCSRGEKCPTG 197

  Fly   372 DCNCMQTTGFMATHLANATGVSPDSGIEFDRWTPSDTGLKXEQSGGKSFVLPPSQEVPFAAAATS 436
            .||...|.|......:||:               :.:.|:.:.|...:    .|..:..::||..
  Fly   198 VCNMDPTKGLFRRRPSNAS---------------THSRLRAQSSNANA----SSSSLSVSSAAAQ 243

  Fly   437 PLPMCLAVNPDNMSPASTTSSSTSTTTTAEAVSVVEMVQHRDQEMAE 483
            ..|    .:|.| ||......|.......|...|:|......:|.||
  Fly   244 SCP----TSPKN-SPLPIVRRSVGNERIPEDEIVLEQPPTTSREAAE 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mkp3NP_001262031.1 DSP_MapKP 8..148 CDD:238723
DSPc 215..353 CDD:238073 47/135 (35%)
CDC14 <242..359 CDD:225297 43/120 (36%)
CG10089NP_001261803.1 DSPc 4..139 CDD:238073 47/135 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462497
Domainoid 1 1.000 44 1.000 Domainoid score I728
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm9172
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.