DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mkp3 and Dusp2

DIOPT Version :9

Sequence 1:NP_001262031.1 Gene:Mkp3 / 40081 FlyBaseID:FBgn0036844 Length:497 Species:Drosophila melanogaster
Sequence 2:NP_001012089.1 Gene:Dusp2 / 311406 RGDID:1305804 Length:318 Species:Rattus norvegicus


Alignment Length:357 Identity:99/357 - (27%)
Similarity:157/357 - (43%) Gaps:90/357 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 DSKDLILLDCRGSHEYSESHIRGAVNLCIP-SIVLRRLAVG--KIDLASTIKSPELKQRIQSGYK 83
            :::..:|||||....:..||:|.|  ..:| :.:|||.|.|  ...||..:....|:.|:     
  Rat    27 EAERTLLLDCRPFLAFCRSHVRAA--RPVPWNALLRRRARGTPAAALACLLPDRALRARL----- 84

  Fly    84 LCWFILYNGEGVPGQNQEIAGAGSL--AVAMDS----------------IISILHRRLKQDGCRV 130
                                |.|.|  ||.:|.                :::.|...::.....|
  Rat    85 --------------------GRGELARAVVLDESSASVAELPPDGPAHLLLAALQHEMRAGPMAV 129

  Fly   131 VALQDGFNNFRQAFPEWCEDDNQTHSKEIESSRNVQTDQLMGLRSLRISTTQSDSACSSSAESSD 195
            ..|:.||.:|:...|:.|.:                            :..|:.....:...|||
  Rat   130 CFLRGGFESFQAYCPDLCSE----------------------------APAQALPPAGAENNSSD 166

  Fly   196 CESSSHHHHHHSHHNYNE-APVEIIPGLLFLGNATHSCDSEALKKYNIKYVLNVTPDLPNKFKES 259
            .....          |:: .||||:| .|:||:..||.|.:.|:...|..||||:...||.|:  
  Rat   167 PRVPI----------YDQGGPVEILP-YLYLGSCNHSSDLQGLQACGITAVLNVSASCPNHFE-- 218

  Fly   260 GDIKYLQIPITDHYSQDLAIHFPDAIQFIEEARSASSVVLVHCLAGVSRSVTVTLAYLMHTRGLS 324
            |..:|..||:.|:...:::..|.:||.||:..:::...|||||.||:|||.|:.||||:.:..:.
  Rat   219 GLFRYKSIPVEDNQMVEISAWFQEAIGFIDSVKNSGGRVLVHCQAGISRSATICLAYLIQSHRVR 283

  Fly   325 LNDAFAMVRDRKPDVSPNFHFMQQLLSFESQL 356
            |::||..|:.|:..:||||.||.|||..|:|:
  Rat   284 LDEAFDFVKQRRGVISPNFSFMGQLLQLETQV 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mkp3NP_001262031.1 DSP_MapKP 8..148 CDD:238723 32/146 (22%)
DSPc 215..353 CDD:238073 59/137 (43%)
CDC14 <242..359 CDD:225297 49/115 (43%)
Dusp2NP_001012089.1 DSP_MapKP 12..147 CDD:238723 32/146 (22%)
DSPc 176..312 CDD:238073 59/138 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X468
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.