DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mkp3 and Dusp26

DIOPT Version :9

Sequence 1:NP_001262031.1 Gene:Mkp3 / 40081 FlyBaseID:FBgn0036844 Length:497 Species:Drosophila melanogaster
Sequence 2:NP_001012352.1 Gene:Dusp26 / 306527 RGDID:1310090 Length:211 Species:Rattus norvegicus


Alignment Length:146 Identity:52/146 - (35%)
Similarity:81/146 - (55%) Gaps:8/146 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   217 EIIPGLLFLGNATHSCDSEALKKYNIKYVLNVTPD----LPNKFKESGDIKYLQIPITDHYSQDL 277
            |:.|| |:||:...:.:...|::..|.:|||.:..    .|..::..| |:||.:...|..:.|:
  Rat    64 EVWPG-LYLGDQDMANNRRELRRLGITHVLNASHSRWRGTPEAYEGLG-IRYLGVEAHDSPAFDM 126

  Fly   278 AIHFPDAIQFIEEARS-ASSVVLVHCLAGVSRSVTVTLAYLMHTRGLSLNDAFAMVRDRKPDVSP 341
            ::||..|..||..|.| ....:||||..|||||.|:.|||||.....:|.:|...|:|.: .:.|
  Rat   127 SVHFQTAADFIHRALSQPGGKILVHCAVGVSRSATLVLAYLMLYHHFTLVEAIKKVKDHR-GIIP 190

  Fly   342 NFHFMQQLLSFESQLR 357
            |..|::|||:.:.:||
  Rat   191 NRGFLRQLLALDRRLR 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mkp3NP_001262031.1 DSP_MapKP 8..148 CDD:238723
DSPc 215..353 CDD:238073 50/140 (36%)
CDC14 <242..359 CDD:225297 45/121 (37%)
Dusp26NP_001012352.1 DSPc 61..202 CDD:238073 50/140 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.