DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mkp3 and Dusp21

DIOPT Version :10

Sequence 1:NP_001262031.1 Gene:Mkp3 / 40081 FlyBaseID:FBgn0036844 Length:497 Species:Drosophila melanogaster
Sequence 2:NP_001100441.1 Gene:Dusp21 / 302867 RGDID:1560427 Length:189 Species:Rattus norvegicus


Alignment Length:134 Identity:43/134 - (32%)
Similarity:70/134 - (52%) Gaps:2/134 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   223 LFLGNATHSCDSEALKKYNIKYVLNVTPDLPNKFKESGDIKYLQIPITDHYSQDLAIHFPDAIQF 287
            ||:.|:..:.|...|...:|..::|.:.::.|.|.|  ||:|:.:|::|..:..|...|......
  Rat    28 LFISNSAVANDKLTLSNNHITTIINASVEVVNTFFE--DIQYVHVPVSDAPNSYLYDFFDPIADH 90

  Fly   288 IEEARSASSVVLVHCLAGVSRSVTVTLAYLMHTRGLSLNDAFAMVRDRKPDVSPNFHFMQQLLSF 352
            |......:...|:||.||||||..:.|||||....::|.||....:..:|.:.||..|.:||:.:
  Rat    91 IHGVEMRNGRTLLHCAAGVSRSAALCLAYLMKYHTMTLLDAHTWTKSCRPIIRPNNGFWEQLIHY 155

  Fly   353 ESQL 356
            |.:|
  Rat   156 EFKL 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mkp3NP_001262031.1 DSP_MapKP 8..148 CDD:238723
DSP_MKP_classII 215..352 CDD:350414 41/128 (32%)
Dusp21NP_001100441.1 PTP_DSP_cys 20..177 CDD:475123 43/134 (32%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.