DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mkp3 and Dusp13b

DIOPT Version :10

Sequence 1:NP_001262031.1 Gene:Mkp3 / 40081 FlyBaseID:FBgn0036844 Length:497 Species:Drosophila melanogaster
Sequence 2:NP_001361004.1 Gene:Dusp13b / 27389 MGIID:1351599 Length:316 Species:Mus musculus


Alignment Length:151 Identity:54/151 - (35%)
Similarity:81/151 - (53%) Gaps:8/151 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   217 EIIPGLLFLGNATHSCDSEALKKYNIKYVLNVTP-----DLPNKFKESGDIKYLQIPITDHYSQD 276
            |:.|. ||||:|..:.|...|.:..|.:|:||..     |...||.....::|..|...|:...|
Mouse   166 EVWPN-LFLGDAYAARDKGRLIQLGITHVVNVAAGKFQVDTGAKFYRGTPLEYYGIEADDNPFFD 229

  Fly   277 LAIHFPDAIQFIEEARS-ASSVVLVHCLAGVSRSVTVTLAYLMHTRGLSLNDAFAMVRDRKPDVS 340
            |::||....::|.:|.: ..|.|||||..|||||.|:.||:||....::|.||...|:..: |:.
Mouse   230 LSVHFLPVARYIRDALNIPRSRVLVHCAMGVSRSATIVLAFLMIFENMTLVDAIQTVQAHR-DIC 293

  Fly   341 PNFHFMQQLLSFESQLRLRPG 361
            ||..|::||...:::||...|
Mouse   294 PNSGFLRQLQVLDNRLRRETG 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mkp3NP_001262031.1 DSP_MapKP 8..148 CDD:238723
DSP_MKP_classII 215..352 CDD:350414 51/140 (36%)
Dusp13bNP_001361004.1 PTP_DSP_cys 146..309 CDD:475123 51/144 (35%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.