DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mkp3 and pmp1

DIOPT Version :9

Sequence 1:NP_001262031.1 Gene:Mkp3 / 40081 FlyBaseID:FBgn0036844 Length:497 Species:Drosophila melanogaster
Sequence 2:NP_595205.1 Gene:pmp1 / 2540019 PomBaseID:SPBC1685.01 Length:278 Species:Schizosaccharomyces pombe


Alignment Length:169 Identity:46/169 - (27%)
Similarity:84/169 - (49%) Gaps:24/169 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   206 HSHHNYNEAPVEIIPGLLFL-GNATHSCDSEALKKYNIKYVLNVTPDLPNKFKESG----DIKY- 264
            :|:..|...||.|.|..::| ...|    ...::.:::  |:||..::.:.|:..|    |.|: 
pombe    52 NSNQPYPNGPVCIYPPNIYLYAKPT----MPIIQSFDV--VINVAKEVLHPFRTDGRHYRDSKHN 110

  Fly   265 LQIPITDHYSQDLAIHFPDAIQFIEE-----------ARSASSVVLVHCLAGVSRSVTVTLAYLM 318
            |.|.:.||. :.:.||:....||..|           |...:..||::|..|:|||..:.:|::|
pombe   111 LDIQVFDHI-EYVHIHWDHDTQFALELDKLVSFVAYNAMQLNKKVLINCQMGISRSACLMIAFIM 174

  Fly   319 HTRGLSLNDAFAMVRDRKPDVSPNFHFMQQLLSFESQLR 357
            .|..|:::||:..|::|.|.:.||...:.||..::..:|
pombe   175 KTLNLNVSDAYEYVKERSPWIGPNMSLIFQLSEYQQIIR 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mkp3NP_001262031.1 DSP_MapKP 8..148 CDD:238723
DSPc 215..353 CDD:238073 43/154 (28%)
CDC14 <242..359 CDD:225297 38/132 (29%)
pmp1NP_595205.1 CDC14 35..227 CDD:225297 46/169 (27%)
DSPc 61..209 CDD:238073 43/154 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10159
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2281
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.040

Return to query results.
Submit another query.