DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mkp3 and Dusp5

DIOPT Version :9

Sequence 1:NP_001262031.1 Gene:Mkp3 / 40081 FlyBaseID:FBgn0036844 Length:497 Species:Drosophila melanogaster
Sequence 2:NP_001078859.1 Gene:Dusp5 / 240672 MGIID:2685183 Length:384 Species:Mus musculus


Alignment Length:463 Identity:127/463 - (27%)
Similarity:197/463 - (42%) Gaps:111/463 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 QLRSLDSKD----LILLDCRGSHEYSESHIRGAVNLCIPSIVLRRLAVGKIDLASTIKSPELKQR 77
            |||.:..|:    .::||||....::.|.:||::|:.:.|:||||...|.:.....:.....:.|
Mouse    10 QLRKMLRKEAEARCVVLDCRPYLAFAASSVRGSLNVNLNSVVLRRARGGAVSARYVLPDEAARAR 74

  Fly    78 -IQSGYKLCWFILYNGEGV-------PGQN--QEIAGAGSLAVAMDSIISILHRRLKQDGCRVVA 132
             :|.|          |.||       .|..  |::....:..|.:.|:::.|     ..|.||..
Mouse    75 LLQEG----------GGGVAAVVVLDQGSRHWQKLREESAARVVLTSLLACL-----PAGPRVYF 124

  Fly   133 LQDGFNNFRQAFPEWCEDDNQTHSKEIESSRNVQTDQLMGLRSLRISTTQSDSACSSSAESSDCE 197
            |:.|:..|...:||.|.|...|..::||..|::.                  |.|.....|....
Mouse   125 LKGGYETFYSQYPECCVDVKPTSQEKIEGERSLL------------------SQCGKPVLSVAYR 171

  Fly   198 SSSHHHHHHSHHNYNE-APVEIIPGLLFLGNATHSCDSEALKKYNIKYVLNVTPDLPNKFKE--S 259
            .:           |:: .||||:| .|:||:|.|:...|.|...:|..:|||:    .:..|  :
Mouse   172 PA-----------YDQGGPVEILP-FLYLGSAYHASKCEFLANLHITALLNVS----RRTSEACT 220

  Fly   260 GDIKYLQIPITDHYSQDLAIHFPDAIQFIEEARSASSVVLVHCLAGVSRSVTVTLAYLMHTRGLS 324
            ..:.|..||:.|.::.|::.||.:||.||:..|.....|||||.||||||.|:.:||||.|:...
Mouse   221 THLHYKWIPVEDSHTADISSHFQEAIDFIDCVREEGGKVLVHCEAGVSRSPTICMAYLMKTKQFR 285

  Fly   325 LNDAFAMVRDRKPDVSPNFHFMQQLLSFESQL-----RLRPGSRFSCSCIAPDCNCMQTTGFMAT 384
            |.:||..|:.|:..|||||.||.|||.:||::     .|:|          |.|   |.....:|
Mouse   286 LKEAFDYVKQRRSVVSPNFGFMGQLLQYESEILPSTPTLQP----------PSC---QGEAASST 337

  Fly   385 HLANATGVSPDSGIEFDRWTPSDTGLKXEQSGGKSFVLPPSQEVPFAAAATSPLPMCLAVNPDNM 449
            .:.:...:|||.                           ......|..:..:|:|....|...:.
Mouse   338 FIGHLQTLSPDM---------------------------QGTYCTFRTSVLAPVPTHSTVPELHR 375

  Fly   450 SPASTTSS 457
            ||.:|.:|
Mouse   376 SPVATATS 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mkp3NP_001262031.1 DSP_MapKP 8..148 CDD:238723 37/144 (26%)
DSPc 215..353 CDD:238073 61/139 (44%)
CDC14 <242..359 CDD:225297 51/123 (41%)
Dusp5NP_001078859.1 DSP_MapKP 5..140 CDD:238723 37/144 (26%)
DSPc 178..314 CDD:238073 61/140 (44%)
CDC14 <227..318 CDD:225297 45/90 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X468
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.