DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mkp3 and C16A3.2

DIOPT Version :9

Sequence 1:NP_001262031.1 Gene:Mkp3 / 40081 FlyBaseID:FBgn0036844 Length:497 Species:Drosophila melanogaster
Sequence 2:NP_498399.1 Gene:C16A3.2 / 182649 WormBaseID:WBGene00015807 Length:221 Species:Caenorhabditis elegans


Alignment Length:172 Identity:55/172 - (31%)
Similarity:82/172 - (47%) Gaps:18/172 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   209 HNYNEAPV-EIIPGLLFLGNATHSCDSEALKKYNIKYVLNVTP-DLPNKFKESGDIK-YLQIPIT 270
            ||.:...: ||:|. |:|...|.|.:||.||:.||..|:||:. ::.|.......|| |....::
 Worm    37 HNLSSRKISEILPN-LYLSGRTVSQNSELLKEKNITTVINVSDREVVNYKNNQKFIKNYRFYAMS 100

  Fly   271 DHYSQDLAIHFPDAIQFIEEARSASSVVLVHCLAGVSRSVTVTLAYLMHTRGLSLNDAFAMVRDR 335
            |..|........:|::.|.::||....|||||..|||||.|:...||:....::..||...:..|
 Worm   101 DTASAKFDGIIEEAVRIIHDSRSKEEGVLVHCFLGVSRSATLVAFYLISALSINWRDAVDFIHHR 165

  Fly   336 KPDVSPNFHFMQQL--------------LSFESQLRLRPGSR 363
            :...:|||.|:.||              |..|..||:|...:
 Worm   166 RFSANPNFGFLHQLKVYSTTKAKEFRNQLISERCLRMRESDK 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mkp3NP_001262031.1 DSP_MapKP 8..148 CDD:238723
DSPc 215..353 CDD:238073 49/154 (32%)
CDC14 <242..359 CDD:225297 40/132 (30%)
C16A3.2NP_498399.1 DSPc 43..182 CDD:238073 48/139 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1717
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.