DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mkp3 and F13D11.3

DIOPT Version :10

Sequence 1:NP_001262031.1 Gene:Mkp3 / 40081 FlyBaseID:FBgn0036844 Length:497 Species:Drosophila melanogaster
Sequence 2:NP_508975.2 Gene:F13D11.3 / 180847 WormBaseID:WBGene00017428 Length:174 Species:Caenorhabditis elegans


Alignment Length:149 Identity:51/149 - (34%)
Similarity:87/149 - (58%) Gaps:8/149 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   210 NYNEAPVEI--IPGLLFLGNATHSCDSEA-LKKYNIKYVLNVTPDLPNKFKESGDIKYLQIPITD 271
            |.|:|.:.|  :...|||  |.:.|.:.: ||:|||.:.::.| :|  |.|....:..:::|:.|
 Worm     3 NQNKALLSITQVRPHLFL--AGYGCITPSLLKQYNITHGVDCT-NL--KTKPIKGLDRIEVPVDD 62

  Fly   272 HYSQDLAIHFPDAIQFIEEARSASSVVLVHCLAGVSRSVTVTLAYLMHTRGLSLNDAFAMVRDRK 336
            :....:..:|...:::||:|:......:::|.||||||.|:|:.|||.|..|||.:|:..|...:
 Worm    63 NTLAKITQYFEPVVKYIEDAKQQGHNTVIYCAAGVSRSATLTIVYLMVTENLSLEEAYLQVNQVR 127

  Fly   337 PDVSPNFHFMQQLLSFESQ 355
            |.:|||..|.:|::.||.|
 Worm   128 PIISPNIGFWRQMIDFEKQ 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mkp3NP_001262031.1 DSP_MapKP 8..148 CDD:238723
DSP_MKP_classII 215..352 CDD:350414 45/139 (32%)
F13D11.3NP_508975.2 DUSP14-like 11..142 CDD:350364 45/135 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.