DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mkp3 and F28C6.8

DIOPT Version :10

Sequence 1:NP_001262031.1 Gene:Mkp3 / 40081 FlyBaseID:FBgn0036844 Length:497 Species:Drosophila melanogaster
Sequence 2:NP_001254161.1 Gene:F28C6.8 / 174381 WormBaseID:WBGene00009207 Length:189 Species:Caenorhabditis elegans


Alignment Length:139 Identity:38/139 - (27%)
Similarity:61/139 - (43%) Gaps:15/139 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   211 YNEAPVEIIPGLLFLGNATHSCDSEALKKYNIKYVLNVTPDLPNK----------FKESGDIKYL 265
            ||.....:|.|.:    ...|...|.::|.|:..|:..|.:...|          :|..| :::.
 Worm    28 YNRVDETLILGAM----PFRSMKDELIQKENVGGVVCCTEEFELKAAMNAMREVDWKNEG-VEFF 87

  Fly   266 QIPITDHYSQDLAIHFPDAIQFIEEARSASSVVLVHCLAGVSRSVTVTLAYLMHTRGLSLNDAFA 330
            .:|:.|...........:|::|||...|....|.|||.||.:||.||...|||.:|....|.|:.
 Worm    88 AVPMKDFTGTAPRAEINEAVEFIESVASKGKTVYVHCKAGRTRSATVATCYLMKSRNWMSNVAWE 152

  Fly   331 MVRDRKPDV 339
            .::|::..|
 Worm   153 FLKDKRHQV 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mkp3NP_001262031.1 DSP_MapKP 8..148 CDD:238723
DSP_MKP_classII 215..352 CDD:350414 36/135 (27%)
F28C6.8NP_001254161.1 PTPMT1 27..177 CDD:350374 38/139 (27%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.