DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mkp3 and DUSP15

DIOPT Version :9

Sequence 1:NP_001262031.1 Gene:Mkp3 / 40081 FlyBaseID:FBgn0036844 Length:497 Species:Drosophila melanogaster
Sequence 2:XP_016883143.1 Gene:DUSP15 / 128853 HGNCID:16236 Length:335 Species:Homo sapiens


Alignment Length:316 Identity:79/316 - (25%)
Similarity:121/316 - (38%) Gaps:85/316 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   217 EIIPGLLFLGNATHSCDSEALKKYNIKYVLNVTPDLPNKFKESGDIKYLQIPITDHYSQDLAIHF 281
            :::|| |:|||...:.|.:.|.:..|.::::: .:.|....:  ||.||:||:.|.....:..||
Human     7 KVLPG-LYLGNFIDAKDLDQLGRNKITHIISI-HESPQPLLQ--DITYLRIPVADTPEVPIKKHF 67

  Fly   282 PDAIQFIEEARSASSVVLVHCLAGVSRSVTVTLAYLMHTRGLSLNDAFAMVRDRKPDVSPNFHFM 346
            .:.|.||...|......||||.||:|||.|:..||:|...||...|....::..:|..:||..|.
Human    68 KECINFIHCCRLNGGNCLVHCFAGISRSTTIVTAYVMTVTGLGWRDVLEAIKATRPIANPNPGFR 132

  Fly   347 QQLLSFESQLRLRPGSRFSC---------------SCIAPDCNCMQ----TTGFMATHLANATGV 392
            |||..|......:.||.|:.               |.:.|  ..:|    |||  |.|..:.|  
Human   133 QQLEEFGWASSQKDGSGFATEDEDKEWPHRLAQQGSLLPP--ILLQALWLTTG--ARHRTSKT-- 191

  Fly   393 SPDSGIEFDRWTPS-----------DTGLKXEQSG-------------GKSFVLPPSQEVPFAAA 433
               ||.:....|.:           ...|. |.:|             .:..:.||    |..||
Human   192 ---SGAQCPPMTSATCLLAARVALLSAALVREATGRTAQRCRLSPRAAAERLLGPP----PHVAA 249

  Fly   434 ATSPLP---MCLAVNPDNMSPASTTSSSTSTTTTAEAVSVVEMVQHRDQEMAEEDI 486
            ..||.|   :||....::..|                      .||..:::...|:
Human   250 GWSPDPKYQICLCFGEEDPGP----------------------TQHPKEQLIMADV 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mkp3NP_001262031.1 DSP_MapKP 8..148 CDD:238723
DSPc 215..353 CDD:238073 46/135 (34%)
CDC14 <242..359 CDD:225297 39/116 (34%)
DUSP15XP_016883143.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.