DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mkp3 and DUSP12

DIOPT Version :10

Sequence 1:NP_001262031.1 Gene:Mkp3 / 40081 FlyBaseID:FBgn0036844 Length:497 Species:Drosophila melanogaster
Sequence 2:NP_009171.1 Gene:DUSP12 / 11266 HGNCID:3067 Length:340 Species:Homo sapiens


Alignment Length:142 Identity:50/142 - (35%)
Similarity:72/142 - (50%) Gaps:5/142 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   216 VEIIPGLLFLGNATHSCDSEALKKYNIKYVLNVTPDLPNKFKES---GDIKYLQIPITDHYSQDL 277
            :|:.|||.| |.|....:.:.|::..|..||.|..:.|: ||..   .|:..|.:|..|....||
Human    28 LEVQPGLYF-GGAAAVAEPDHLREAGITAVLTVDSEEPS-FKAGPGVEDLWRLFVPALDKPETDL 90

  Fly   278 AIHFPDAIQFIEEARSASSVVLVHCLAGVSRSVTVTLAYLMHTRGLSLNDAFAMVRDRKPDVSPN 342
            ..|....:.||.:||:....|||||.|||||||.:..|:||.|..|....|:..::..||:...|
Human    91 LSHLDRCVAFIGQARAEGRAVLVHCHAGVSRSVAIITAFLMKTDQLPFEKAYEKLQILKPEAKMN 155

  Fly   343 FHFMQQLLSFES 354
            ..|..||..:::
Human   156 EGFEWQLKLYQA 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mkp3NP_001262031.1 DSP_MapKP 8..148 CDD:238723
DSP_MKP_classII 215..352 CDD:350414 50/138 (36%)
DUSP12NP_009171.1 DSP_DUSP12 27..173 CDD:350370 50/142 (35%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.