DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mkp3 and DUSP10

DIOPT Version :9

Sequence 1:NP_001262031.1 Gene:Mkp3 / 40081 FlyBaseID:FBgn0036844 Length:497 Species:Drosophila melanogaster
Sequence 2:NP_009138.1 Gene:DUSP10 / 11221 HGNCID:3065 Length:482 Species:Homo sapiens


Alignment Length:363 Identity:117/363 - (32%)
Similarity:175/363 - (48%) Gaps:77/363 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 CSKEWLQSQLRSLDSKDLILLDCRGSHEYSESHIRGAVNL-CIPSIVLRRLAVGKI---DLASTI 69
            |||..|.||       ..:::|||...||::|||:|||:: |...|..|||..|||   ||.|..
Human   162 CSKSHLPSQ-------GPVIIDCRPFMEYNKSHIQGAVHINCADKISRRRLQQGKITVLDLISCR 219

  Fly    70 KSPELKQRIQSGYKLCWFILYNGEGVPGQNQEIAGAGSLAVAMDSIISILHRRLKQDGCRVVALQ 134
            :..:..:||.|..    .|:|:..  ..:...:..:..|.:.::|        ||::|...:.|:
Human   220 EGKDSFKRIFSKE----IIVYDEN--TNEPSRVMPSQPLHIVLES--------LKREGKEPLVLK 270

  Fly   135 DGFNNFRQAFPEWCEDDNQTHSKEIESSRNVQTDQLMGLRSLRISTTQSDSACSSSAESS----- 194
            .|.::|:|.....|:     :|.:::..|.|                    ...:||.||     
Human   271 GGLSSFKQNHENLCD-----NSLQLQECREV--------------------GGGASAASSLLPQP 310

  Fly   195 -----DCESSSHHHHHHSHHNYNEAPVEIIPGLLFLGNATHSCDSEALKKYNIKYVLNVTPDLPN 254
                 |.|              |.....|:| .|||||...:.|.:.:::.||.||:|||..||.
Human   311 IPTTPDIE--------------NAELTPILP-FLFLGNEQDAQDLDTMQRLNIGYVINVTTHLPL 360

  Fly   255 KFKESGDIKYLQIPITDHYSQDLAIHFPDAIQFIEEARSASSVVLVHCLAGVSRSVTVTLAYLM- 318
            ...|.|...|.::|.||...|:|..:|.:|.:|||||......:|:||.||||||.|:.:|||| 
Human   361 YHYEKGLFNYKRLPATDSNKQNLRQYFEEAFEFIEEAHQCGKGLLIHCQAGVSRSATIVIAYLMK 425

  Fly   319 HTRGLSLNDAFAMVRDRKPDVSPNFHFMQQLLSFESQL 356
            ||| :::.||:..|:.::|.:|||.:||.|||.||..|
Human   426 HTR-MTMTDAYKFVKGKRPIISPNLNFMGQLLEFEEDL 462

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mkp3NP_001262031.1 DSP_MapKP 8..148 CDD:238723 42/142 (30%)
DSPc 215..353 CDD:238073 61/138 (44%)
CDC14 <242..359 CDD:225297 55/116 (47%)
DUSP10NP_009138.1 DSP_MapKP 149..284 CDD:238723 42/142 (30%)
Interaction with MAP kinases 199..215 7/15 (47%)
DSPc 321..459 CDD:238073 61/139 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D389486at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2281
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.950

Return to query results.
Submit another query.