DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mkp3 and DUSP14

DIOPT Version :10

Sequence 1:NP_001262031.1 Gene:Mkp3 / 40081 FlyBaseID:FBgn0036844 Length:497 Species:Drosophila melanogaster
Sequence 2:NP_008957.1 Gene:DUSP14 / 11072 HGNCID:17007 Length:198 Species:Homo sapiens


Alignment Length:142 Identity:45/142 - (31%)
Similarity:73/142 - (51%) Gaps:10/142 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   219 IPGLLFLGNATHSCDSEALKKYNIKYVLNVTPDLPN----KFKESGDIKYLQIPITDHYSQDLAI 279
            |...||||..:.:.:...|:...|..::|.|.::||    :|      :|:::|:.|.....:.:
Human    30 ITSSLFLGRGSVASNRHLLQARGITCIVNATIEIPNFNWPQF------EYVKVPLADMPHAPIGL 88

  Fly   280 HFPDAIQFIEEARSASSVVLVHCLAGVSRSVTVTLAYLMHTRGLSLNDAFAMVRDRKPDVSPNFH 344
            :|......|..........||||.||||||.|:.:||||....:.|.:|:..|:.|:|.:.||..
Human    89 YFDTVADKIHSVSRKHGATLVHCAAGVSRSATLCIAYLMKFHNVCLLEAYNWVKARRPVIRPNVG 153

  Fly   345 FMQQLLSFESQL 356
            |.:||:.:|.||
Human   154 FWRQLIDYERQL 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mkp3NP_001262031.1 DSP_MapKP 8..148 CDD:238723
DSP_MKP_classII 215..352 CDD:350414 42/136 (31%)
DUSP14NP_008957.1 DUSP14 20..169 CDD:350420 45/142 (32%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.