DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mkp3 and styx

DIOPT Version :10

Sequence 1:NP_001262031.1 Gene:Mkp3 / 40081 FlyBaseID:FBgn0036844 Length:497 Species:Drosophila melanogaster
Sequence 2:NP_001135695.1 Gene:styx / 100216269 XenbaseID:XB-GENE-967347 Length:223 Species:Xenopus tropicalis


Alignment Length:146 Identity:48/146 - (32%)
Similarity:81/146 - (55%) Gaps:12/146 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   217 EIIPGLLFLG--NATHSCDSEALKKYNIKYVLNVTPDL------PNKFKESGDIKYLQIPITDHY 273
            ||:|| ||||  :|........|:|..|.:|:.:..::      || |::.  .:||.:.|.|:.
 Frog    31 EILPG-LFLGPYSAAMKSKLSVLQKCGITHVICIRQNIEANFIKPN-FQQL--FRYLVLDIADNP 91

  Fly   274 SQDLAIHFPDAIQFIEEARSASSVVLVHCLAGVSRSVTVTLAYLMHTRGLSLNDAFAMVRDRKPD 338
            .:::...||.:.:||:........||:|..||:|||..:.:||:|.|.|:...|||..|::|:..
 Frog    92 VENIIRFFPMSKEFIDGCLQTGGKVLIHGNAGISRSAALVIAYIMETFGIKYRDAFTYVQERRFC 156

  Fly   339 VSPNFHFMQQLLSFES 354
            ::||..|:.||..:|:
 Frog   157 INPNAGFVHQLQEYEA 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mkp3NP_001262031.1 DSP_MapKP 8..148 CDD:238723
DSP_MKP_classII 215..352 CDD:350414 47/142 (33%)
styxNP_001135695.1 DSP_STYX 25..175 CDD:350372 48/146 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.