DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sfxn2 and Sfxn5

DIOPT Version :9

Sequence 1:NP_649086.2 Gene:Sfxn2 / 40080 FlyBaseID:FBgn0036843 Length:327 Species:Drosophila melanogaster
Sequence 2:XP_006506879.1 Gene:Sfxn5 / 94282 MGIID:2137681 Length:362 Species:Mus musculus


Alignment Length:344 Identity:118/344 - (34%)
Similarity:176/344 - (51%) Gaps:40/344 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 KPLFDLSTFAGRFQYFAWMTDPRTVVVSSDRLLEAKAMVERYRKGDQSPPLKPEEVHYNMKLYNS 76
            ||.|..::|.|||::|..:.||||:.|:..||.||..::|.|:.|...|.:..|::....|:..:
Mouse    31 KPRFQQTSFYGRFRHFLDIIDPRTLFVTEKRLREAVQLLEDYKHGTLRPGVTNEQLWSAQKIKQA 95

  Fly    77 AFHPDTGELQNFCGRMSFQVPGGMLITGGMLAFYRTVPAVVLWQFINQSFNAVVNYTNRNANSPT 141
            ..||||.|......|||..:|.|..|..|:|...:|:.:.|.||::|||.||.|||.||||..|:
Mouse    96 ILHPDTNEKIFMPFRMSGYIPFGTPIVVGLLLPNQTLASTVFWQWLNQSHNACVNYANRNATKPS 160

  Fly   142 SVTQLGVAYVSATTSALVAAIGCKNYWSK--KATP----LFQRFVPFAA---------------- 184
            ..::....|:.|..||:..|:|......|  |.||    |.||||||.|                
Mouse   161 PASKFIQGYLGAVISAVSIAVGLNVLVQKANKFTPATRLLVQRFVPFPAVGNNRDGGLCRRKEWD 225

  Fly   185 ----VAAANFVNIPLMRQNEIINGIEVKNDDGVVVGQSRLAAIKGIGEVVVSRIAMAAPGMLVLP 245
                |::||..|:.|||..|:..||:|.:.||.:||.|::||...:.|..::|:.:..|.:::.|
Mouse   226 ARESVSSANICNVVLMRYGELEEGIDVLDADGNLVGSSKIAARHALLETALTRVVLPMPILVLPP 290

  Fly   246 LIMERLEKLPAYRRIKWINAPFQTLLVGCFLCF--MVPTACALFPQQCSLDTSIMRTFEPELYED 308
            ::|..|||....:....:..|..:|:  |...|  .:|.|.:||||...::||   ..|||:...
Mouse   291 IVMSMLEKTALLQARPRLLLPVHSLV--CLAAFGLALPLAISLFPQMSEIETS---QLEPEIARA 350

  Fly   309 LEKKTQGKVPKRVYFNKGL 327
            ...:|       |.:||||
Mouse   351 TSSRT-------VVYNKGL 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sfxn2NP_649086.2 Mtc 15..327 CDD:309082 114/339 (34%)
Sfxn5XP_006506879.1 Mtc 34..362 CDD:367676 114/339 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3767
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S929
OMA 1 1.010 - - QHG53494
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.770

Return to query results.
Submit another query.