DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sfxn2 and SFXN1

DIOPT Version :9

Sequence 1:NP_649086.2 Gene:Sfxn2 / 40080 FlyBaseID:FBgn0036843 Length:327 Species:Drosophila melanogaster
Sequence 2:NP_001309906.1 Gene:SFXN1 / 94081 HGNCID:16085 Length:322 Species:Homo sapiens


Alignment Length:322 Identity:163/322 - (50%)
Similarity:213/322 - (66%) Gaps:10/322 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 IDVDKPLFDLSTFAGRFQYFAWMTDPRTVVVSSDRLLEAKAMVERYRKGDQSPPLKPEEVHYNMK 72
            |::.:|.:|.|||.||..:|..:||||.:::::::|..|:.:|..||:|...|.|...|:.....
Human     9 INIKEPRWDQSTFIGRANHFFTVTDPRNILLTNEQLESARKIVHDYRQGIVPPGLTENELWRAKY 73

  Fly    73 LYNSAFHPDTGELQNFCGRMSFQVPGGMLITGGMLAFYRTVPAVVLWQFINQSFNAVVNYTNRNA 137
            :|:|||||||||.....||||.|||..|.|||.|:.||||.|||:.||:||||||||||||||:.
Human    74 IYDSAFHPDTGEKMILIGRMSAQVPMNMTITGCMMTFYRTTPAVLFWQWINQSFNAVVNYTNRSG 138

  Fly   138 NSPTSVTQLGVAYVSATTSALVAAIGCKNYWSKKATPLFQRFVPFAAVAAANFVNIPLMRQNEII 202
            ::|.:|.:||.|||||||.|:..|:|. |..:|..:||..||||||||||||.:|||||||.|:.
Human   139 DAPLTVNELGTAYVSATTGAVATALGL-NALTKHVSPLIGRFVPFAAVAAANCINIPLMRQRELK 202

  Fly   203 NGIEVKNDDGVVVGQSRLAAIKGIGEVVVSRIAMAAPGMLVLPLIMERLEKLPAYRRIKWINAPF 267
            .||.|.:::|..:|:|..||.:.|.:||||||.||||||.:.|.||..|||....:|..|::||.
Human   203 VGIPVTDENGNRLGESANAAKQAITQVVVSRILMAAPGMAIPPFIMNTLEKKAFLKRFPWMSAPI 267

  Fly   268 QTLLVGCFLCFMVPTACALFPQQCSLDTSIMRTFEPELYEDLEKKTQGKVP--KRVYFNKGL 327
            |..|||..|.|..|..||||||:.|:..:       .|..:|:.|.|...|  :||||||||
Human   268 QVGLVGFCLVFATPLCCALFPQKSSMSVT-------SLEAELQAKIQESHPELRRVYFNKGL 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sfxn2NP_649086.2 Mtc 15..327 CDD:309082 159/313 (51%)
SFXN1NP_001309906.1 Mtc 10..322 CDD:397754 160/319 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3767
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53494
OrthoDB 1 1.010 - - D340335at33208
OrthoFinder 1 1.000 - - FOG0000786
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X842
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.830

Return to query results.
Submit another query.