DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sfxn2 and sfxn4

DIOPT Version :9

Sequence 1:NP_649086.2 Gene:Sfxn2 / 40080 FlyBaseID:FBgn0036843 Length:327 Species:Drosophila melanogaster
Sequence 2:NP_001070130.1 Gene:sfxn4 / 556121 ZFINID:ZDB-GENE-050309-187 Length:316 Species:Danio rerio


Alignment Length:322 Identity:80/322 - (24%)
Similarity:149/322 - (46%) Gaps:32/322 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 TFAGRFQYFAWMTDPRTVVVSSDRLLEAKAMVERYRKGDQSPPLKPEEVHYNMKLYNSAFHPDTG 83
            :|..|...::.:.|| |:::|...:.||:.:::    .:::.|.|.::|.....|..|:.|.|||
Zfish    14 SFLSRLGLWSKILDP-TLLLSQAEIEEARTLIQ----NEENTPGKNDKVSNAWLLSLSSVHSDTG 73

  Fly    84 ELQNFCGRMSFQVP-GGMLITGGMLAFYRTVPAVVLWQFINQSFNAVVNYTNRNA----NSPTSV 143
            .:.:...|....:| ...|:.|.::| ::.:.:.:.|||:..::.|..|:.||||    ::.|::
Zfish    74 AVISPAYRPQVFLPISAPLVVGSLIA-HKGIKSAMFWQFVLHAYCAGFNHANRNATATKDNKTTM 137

  Fly   144 TQ----LGVAYVSATTSALVAAIGCK-NYWSKKATPLFQRFVPFAAVAAANFVNIPLMRQNEIIN 203
            .|    ||....|..|.||...|..: ...|.....:.:.|:|....|.....||.::|..|..|
Zfish   138 KQSLLILGAVSYSTVTGALPQIILQRLRLISSLTQTICRSFLPVPLAAGLAAFNILVVRSEEAEN 202

  Fly   204 GIEVKNDDGVVVGQSRLAAIKGIGEVVVSRIAMAAPGMLVLPLIMERLEKLPAYRRIKWINAPFQ 268
            ||.:.:.:|..||.|:.|..|.:.|..:||..:......:...:|..||:....:|...:.||..
Zfish   203 GISLFDANGNAVGVSKEAGFKAVKETAISRATLFGTTAALPTFLMALLERAKFVQRNPRLIAPIG 267

  Fly   269 TLLVGCFLCFMVPTACALFPQQCSLDTSIMRTFEPELYEDLEKKTQ---GKVPKRVYFNKGL 327
            ::........|:|.:.:||||...:..           |:|||:.|   |.  :.:::::||
Zfish   268 SMCTVITFGLMIPVSFSLFPQLGKIKK-----------ENLEKEFQSLDGN--EELFYHRGL 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sfxn2NP_649086.2 Mtc 15..327 CDD:309082 78/320 (24%)
sfxn4NP_001070130.1 Mtc 13..316 CDD:281771 78/320 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3767
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D881974at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.