DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sfxn2 and sfxn1

DIOPT Version :9

Sequence 1:NP_649086.2 Gene:Sfxn2 / 40080 FlyBaseID:FBgn0036843 Length:327 Species:Drosophila melanogaster
Sequence 2:NP_001003537.1 Gene:sfxn1 / 445143 ZFINID:ZDB-GENE-040801-45 Length:322 Species:Danio rerio


Alignment Length:324 Identity:160/324 - (49%)
Similarity:216/324 - (66%) Gaps:6/324 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 VSTLIDVDKPLFDLSTFAGRFQYFAWMTDPRTVVVSSDRLLEAKAMVERYRKGDQSPPLKPEEVH 68
            :||.|::.:|.:|..||.||.::|..:||||.:::|:.:|.:|..:::.|:||..:..|..:|:.
Zfish     5 ISTSINIKEPRWDQGTFVGRAKHFFTVTDPRNILLSNKQLEKAHQIIQDYKKGVVAADLTEDELW 69

  Fly    69 YNMKLYNSAFHPDTGELQNFCGRMSFQVPGGMLITGGMLAFYRTVPAVVLWQFINQSFNAVVNYT 133
            ....:::|||||||||.....||||.|||..|.|||.|:.||||.|||:.||:|||||||:||||
Zfish    70 RAKYVFDSAFHPDTGEKMLLIGRMSAQVPMNMTITGCMMTFYRTTPAVLFWQWINQSFNAIVNYT 134

  Fly   134 NRNANSPTSVTQLGVAYVSATTSALVAAIGCKNYWSKKATPLFQRFVPFAAVAAANFVNIPLMRQ 198
            ||:.::|.:|.|||.|||||||.|:..|:| .|..:|..:||..||||||||||||.:|||||||
Zfish   135 NRSGDAPITVNQLGTAYVSATTGAVATALG-PNALAKHVSPLIGRFVPFAAVAAANCINIPLMRQ 198

  Fly   199 NEIINGIEVKNDDGVVVGQSRLAAIKGIGEVVVSRIAMAAPGMLVLPLIMERLEKLPAYRRIKWI 263
            .|:.:||.|.:::...:|:|..||.:.|.:||||||.||:|||.:.|.:|..|||....:|..|:
Zfish   199 RELKHGIPVTDENDNRLGESSKAAQQAITQVVVSRILMASPGMAIPPFLMNSLEKKAFLKRFPWM 263

  Fly   264 NAPFQTLLVGCFLCFMVPTACALFPQQCSLDTSIMRTFEPELYEDLEKKTQGKVPKRVYFNKGL 327
            :||.|..|||..|.|..|..||||||:.|:..|   ..||||.|.:.....|  .:.|||||||
Zfish   264 SAPIQVGLVGFCLVFATPLCCALFPQKSSMAVS---RLEPELQEKIRASHPG--VETVYFNKGL 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sfxn2NP_649086.2 Mtc 15..327 CDD:309082 154/311 (50%)
sfxn1NP_001003537.1 Mtc 16..322 CDD:281771 154/311 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53494
OrthoDB 1 1.010 - - D340335at33208
OrthoFinder 1 1.000 - - FOG0000786
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X842
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.