DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sfxn2 and Sfxn1

DIOPT Version :9

Sequence 1:NP_649086.2 Gene:Sfxn2 / 40080 FlyBaseID:FBgn0036843 Length:327 Species:Drosophila melanogaster
Sequence 2:NP_001012213.1 Gene:Sfxn1 / 364678 RGDID:1308482 Length:322 Species:Rattus norvegicus


Alignment Length:327 Identity:161/327 - (49%)
Similarity:213/327 - (65%) Gaps:10/327 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 QVSTLIDVDKPLFDLSTFAGRFQYFAWMTDPRTVVVSSDRLLEAKAMVERYRKGDQSPPLKPEEV 67
            :|...|::.:|.:|.|||.||..:|..:||||.:::::::|..|:.:|..||:|.....|...|:
  Rat     4 EVPPNINIKEPRWDQSTFIGRASHFFTVTDPRNILLTNEQLENARKVVHDYRQGIVPAGLTENEL 68

  Fly    68 HYNMKLYNSAFHPDTGELQNFCGRMSFQVPGGMLITGGMLAFYRTVPAVVLWQFINQSFNAVVNY 132
            ......|:|||||||||.....||||.|||..|.|||.|:.||||.|||:.||:|||||||||||
  Rat    69 WRAKYAYDSAFHPDTGEKMTLIGRMSAQVPMNMTITGCMMTFYRTTPAVLFWQWINQSFNAVVNY 133

  Fly   133 TNRNANSPTSVTQLGVAYVSATTSALVAAIGCKNYWSKKATPLFQRFVPFAAVAAANFVNIPLMR 197
            |||:.::|.:|.:||.|||||||.|:..|:|. |..:|..:||..||||||||||||.:||||||
  Rat   134 TNRSGDAPLTVNELGTAYVSATTGAVATALGL-NALTKHVSPLIGRFVPFAAVAAANCINIPLMR 197

  Fly   198 QNEIINGIEVKNDDGVVVGQSRLAAIKGIGEVVVSRIAMAAPGMLVLPLIMERLEKLPAYRRIKW 262
            |.|:..||.|.:::|..:|:|..||.:.|.:||:|||.||||||.:.|.||..|||....:|..|
  Rat   198 QRELKVGIPVTDENGTRLGESTNAAKQAITQVVISRILMAAPGMAIPPFIMNTLEKKAFLKRFPW 262

  Fly   263 INAPFQTLLVGCFLCFMVPTACALFPQQCSLDTSIMRTFEPELYEDLEKKTQGKVP--KRVYFNK 325
            ::||.|..|||..|.|..|..||||||:.|:..:       .|.::|:...|...|  :||||||
  Rat   263 MSAPIQVTLVGFCLVFATPLCCALFPQKSSMSVT-------SLEDELQASIQKSHPELRRVYFNK 320

  Fly   326 GL 327
            ||
  Rat   321 GL 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sfxn2NP_649086.2 Mtc 15..327 CDD:309082 156/313 (50%)
Sfxn1NP_001012213.1 Mtc 16..322 CDD:281771 156/313 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3767
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53494
OrthoDB 1 1.010 - - D340335at33208
OrthoFinder 1 1.000 - - FOG0000786
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X842
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.830

Return to query results.
Submit another query.