DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sfxn2 and Sfxn2

DIOPT Version :9

Sequence 1:NP_649086.2 Gene:Sfxn2 / 40080 FlyBaseID:FBgn0036843 Length:327 Species:Drosophila melanogaster
Sequence 2:NP_001013090.1 Gene:Sfxn2 / 294011 RGDID:1306131 Length:144 Species:Rattus norvegicus


Alignment Length:135 Identity:84/135 - (62%)
Similarity:102/135 - (75%) Gaps:0/135 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 DVDKPLFDLSTFAGRFQYFAWMTDPRTVVVSSDRLLEAKAMVERYRKGDQSPPLKPEEVHYNMKL 73
            ::|.|.:|..||.||.::|..:||||||.||...|..||::||:.|.|...|..:.|::.|..||
  Rat     9 NIDAPRWDQCTFLGRVKHFFNITDPRTVFVSEQELDWAKSVVEKSRMGLMPPGTQVEQLLYAKKL 73

  Fly    74 YNSAFHPDTGELQNFCGRMSFQVPGGMLITGGMLAFYRTVPAVVLWQFINQSFNAVVNYTNRNAN 138
            |:|||||||||..|..|||||||||||:|||.||.||||:||||.||::||||||:||||||||.
  Rat    74 YDSAFHPDTGEKMNVIGRMSFQVPGGMIITGFMLQFYRTMPAVVFWQWVNQSFNALVNYTNRNAV 138

  Fly   139 SPTSV 143
            |||||
  Rat   139 SPTSV 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sfxn2NP_649086.2 Mtc 15..327 CDD:309082 82/129 (64%)
Sfxn2NP_001013090.1 Mtc 15..>144 CDD:296347 82/129 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166334693
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3767
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D340335at33208
OrthoFinder 1 1.000 - - FOG0000786
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_109681
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.650

Return to query results.
Submit another query.