DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sfxn2 and Sfxn5

DIOPT Version :9

Sequence 1:NP_649086.2 Gene:Sfxn2 / 40080 FlyBaseID:FBgn0036843 Length:327 Species:Drosophila melanogaster
Sequence 2:XP_038963069.1 Gene:Sfxn5 / 261737 RGDID:628706 Length:361 Species:Rattus norvegicus


Alignment Length:313 Identity:114/313 - (36%)
Similarity:171/313 - (54%) Gaps:11/313 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 KPLFDLSTFAGRFQYFAWMTDPRTVVVSSDRLLEAKAMVERYRKGDQSPPLKPEEVHYNMKLYNS 76
            ||.|..::|.|||::|..:.||||:.|:..||.||..::|.|:.|...|.:..|::....|:..:
  Rat    31 KPRFQQTSFYGRFRHFLDIIDPRTLFVTEKRLREAVQLLEDYKHGTLRPGVTNEQLWSAQKIKQA 95

  Fly    77 AFHPDTGELQNFCGRMSFQVPGGMLITGGMLAFYRTVPAVVLWQFINQSFNAVVNYTNRNANSPT 141
            ..||||.|......|||..:|.|..|..|:|...:|:.:.|.||::|||.||.|||.||||..|:
  Rat    96 ILHPDTNEKIFMPFRMSGYIPFGTPIVVGLLLPNQTLASTVFWQWLNQSHNACVNYANRNATKPS 160

  Fly   142 SVTQLGVAYVSATTSALVAAIGCKNYWSK--KATP----LFQRFVPFAAVAAANFVNIPLMRQNE 200
            ..::....|:.|..||:..|:|......|  |.||    |.||||||.|||:||..|:.|||..|
  Rat   161 PASKFIQGYLGAVISAVSIAVGLNVLVQKANKFTPATRLLVQRFVPFPAVASANICNVVLMRYGE 225

  Fly   201 IINGIEVKNDDGVVVGQSRLAAIKGIGEVVVSRIAMAAPGMLVLPLIMERLEKLPAYRRIKWINA 265
            :..||:|.:.||.:||.|::||...:.|..::|:.:..|.:::.|::|..|||....:....:..
  Rat   226 LEEGIDVLDADGNLVGSSKIAARHALLETALTRVVLPMPILVLPPIVMSMLEKTALLQARPRLLL 290

  Fly   266 PFQTLLVGCFLCF--MVPTACALFPQQCSLDTSI-MRTFEPELYEDLEKKTQG 315
            |..:|:  |...|  .:|.|.:||||...:..|| :...:.|:..|..:|..|
  Rat   291 PVHSLV--CLAAFGLALPLAISLFPQMSEVQLSIEILPGQSEVVVDSSRKRPG 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sfxn2NP_649086.2 Mtc 15..327 CDD:309082 112/310 (36%)
Sfxn5XP_038963069.1 Mtc 29..321 CDD:397754 108/291 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3767
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53494
OrthoDB 1 1.010 - - D340335at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.830

Return to query results.
Submit another query.