DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sfxn2 and sfxn-5

DIOPT Version :9

Sequence 1:NP_649086.2 Gene:Sfxn2 / 40080 FlyBaseID:FBgn0036843 Length:327 Species:Drosophila melanogaster
Sequence 2:NP_001022022.1 Gene:sfxn-5 / 174303 WormBaseID:WBGene00044049 Length:331 Species:Caenorhabditis elegans


Alignment Length:333 Identity:118/333 - (35%)
Similarity:177/333 - (53%) Gaps:38/333 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 KPLFDLSTFAGRFQYFAWMTDPRTVVVSSDRLLEAKAMVERYRKGDQSPPLKPEEVHYNMKLYNS 76
            :|.|...||.||:.:...:.||||:..|:.:|.|:..::..::.| .:..:..:.:....||.::
 Worm    20 EPRFPQDTFLGRYLHCLDVIDPRTLFASNKKLEESLELLNSFKAG-TATNVPDKSLWEAQKLKSA 83

  Fly    77 AFHPDTGE--LQNFCGRMSFQVPGGMLITGGMLAFYRTVPAVVLWQFINQSFNAVVNYTNRNANS 139
            ..||||||  |..|  |||..||.|.:...|||....:.|.::.||::|||.||.|||.||||..
 Worm    84 ILHPDTGEKVLPPF--RMSGFVPFGWITVTGMLLPNPSWPTLLFWQWMNQSHNACVNYANRNATQ 146

  Fly   140 PTSVTQLGVAYVSATTSALVAAIGCKNYWSKKATPL-------FQRFVPFAAVAAANFVNIPLMR 197
            |..:::...||.:|.|:| .:..|...|:.|||:.|       .|||||..|.:.|:.:|:..||
 Worm   147 PQPLSKYIGAYGAAVTAA-CSISGGLTYFIKKASSLPPTTRIIIQRFVPLPATSLASSLNVICMR 210

  Fly   198 QNEIINGIEV-KNDDGVVVGQSRLAAIKGIGEVVVSRIAMAAPGMLVLPLIMERLEKLPAYRRIK 261
            .||:..||:| :.|.|.|||.|::||.:.:.:..:.|..:..|.:|:.|.||..||      |.|
 Worm   211 WNELETGIQVYEKDTGKVVGVSKVAAKQAVTDTTMVRAFLPVPLLLMPPCIMPYLE------RFK 269

  Fly   262 WINAP-----FQTLLVGCFLCFMV--PTACALFPQQCSLDTSIMRTFEPELYEDLEKKTQGKVPK 319
            |:...     |...:| |.|.|.|  |.|.|||||:.::.   ....|||    |::||:..:  
 Worm   270 WVTKTQVRHIFVNAIV-CTLSFAVSLPVALALFPQESAIS---REQLEPE----LQQKTKNSL-- 324

  Fly   320 RVYFNKGL 327
             :|:||||
 Worm   325 -LYYNKGL 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sfxn2NP_649086.2 Mtc 15..327 CDD:309082 115/328 (35%)
sfxn-5NP_001022022.1 mtc 14..331 CDD:129880 116/331 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3767
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S929
OMA 1 1.010 - - QHG53494
OrthoDB 1 1.010 - - D340335at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.780

Return to query results.
Submit another query.