DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sfxn2 and sfxn4

DIOPT Version :9

Sequence 1:NP_649086.2 Gene:Sfxn2 / 40080 FlyBaseID:FBgn0036843 Length:327 Species:Drosophila melanogaster
Sequence 2:XP_017951465.1 Gene:sfxn4 / 100487071 XenbaseID:XB-GENE-6459672 Length:371 Species:Xenopus tropicalis


Alignment Length:327 Identity:84/327 - (25%)
Similarity:145/327 - (44%) Gaps:41/327 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 QYFAW--MTDPRTVVVSSDRLLEAKAMVERYRKGDQSPPL-KPEEVHYNMKLYNSAFHPDTGELQ 86
            :|..|  :.||.|::.|...:..::|::|..  |..:... :..:|:...||...:.|||||.:.
 Frog    62 RYLRWVDILDPTTLLSSDAEIKNSRALLESL--GITNKDFTQDRKVNDAQKLCEVSVHPDTGNVI 124

  Fly    87 NFCGR----MSFQVPGGML-----ITGGMLAFYRTVPAVVLWQFINQSFNAVVNYTNRNA----- 137
            ....|    |....|..:|     ....:|....|.|| ..|||:..:::|..|..|||.     
 Frog   125 PTIFRPPAFMPLATPLCLLSFLLQAVATLLPHIGTKPA-FFWQFLFHTYSAGFNLHNRNGTCKPK 188

  Fly   138 -NSP-TSVTQLGVAYVSATTSALVAAIG--CKNYWSKKATPL---FQRFVPFAAVAAANFVNIPL 195
             :.| .||..:|    |.|..|.:.|:.  ..|.:..::|.:   ..|.:|...|...:..|:..
 Frog   189 KSQPFQSVLLVG----SVTYFAFLGALPQFLMNRYKFRSTAMQTFLGRLLPVPLVTFLSAFNVVA 249

  Fly   196 MRQNEIINGIEVKNDDGVVVGQSRLAAIKGIGEVVVSRIAMAAPGMLVLPLIMERLEKLPAYRRI 260
            :|..|..:|||||:..|.|:|.|..|..|.:.|..:||.|:.....:|...:...|::...:.|.
 Frog   250 VRLQETEDGIEVKDKSGNVIGTSSQAGYKAVKETALSRAALMGITAVVPAALHPLLQRSRFFLRN 314

  Fly   261 KWINAPFQTLLVGCFLCFMVPTACALFPQQCSLDTSIMRTFEPELYEDLEKKTQGKVPKRVYFNK 325
            ....||.:.:........|:|.:.:|||:|    .:|:|:   ||..:|::.|:..|   :::.:
 Frog   315 SVALAPIKYVATALTFGAMIPVSFSLFPRQ----GTILRS---ELELELQENTREPV---LFYQR 369

  Fly   326 GL 327
            ||
 Frog   370 GL 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sfxn2NP_649086.2 Mtc 15..327 CDD:309082 82/325 (25%)
sfxn4XP_017951465.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D881974at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.