DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp76A and SERPINB11

DIOPT Version :9

Sequence 1:NP_524153.1 Gene:Acp76A / 40078 FlyBaseID:FBgn0015586 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_001357404.1 Gene:SERPINB11 / 89778 HGNCID:14221 Length:392 Species:Homo sapiens


Alignment Length:388 Identity:76/388 - (19%)
Similarity:153/388 - (39%) Gaps:74/388 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 NVSF--QLIREID-RYTPENFVLSVLNIEMILFEIHAAKAVESNNDLERSLIINFGY-------- 77
            ||.|  .:.:|:: ....:|...|.|::...|..:......|:...||:  :::|.:        
Human     8 NVEFCLDVFKELNSNNIGDNIFFSSLSLLYALSMVLLGARGETEEQLEK--VLHFSHTVDSLKPG 70

  Fly    78 -------SEARQEVLDWGLRYKKA----SSAKFQMANKVAVSQKLPLSQKLRLVNEVLMTSAKKY 131
                   |:|.:...::|:.:.:.    |:....:||::..::.:...|      :.|..|.|.|
Human    71 FKDSPKCSQAGRIHSEFGVEFSQINQPDSNCTLSIANRLYGTKTMAFHQ------QYLSCSEKWY 129

  Fly   132 DV---TKDVRPS-----KLMDEWLSSHLDGVLANFVQEKKLNAGENIVAISGMTVTPLWASHFQS 188
            ..   |.|...|     |.::.|:.:..:|.:||...:..::....:|.::.:.....|.:.||.
Human   130 QARLQTVDFEQSTEETRKTINAWVENKTNGKVANLFGKSTIDPSSVMVLVNAIYFKGQWQNKFQV 194

  Fly   189 EINRYFVNNPGTGYASKDPTCVPMMHSLSSFET--MSTDEAKGIYIPFSSANLGMLILLPRKGVT 251
               |..|.:|......|:.| |.||:.:.:|:.  :...:.:.:.:|:.:..|.|:||||.....
Human   195 ---RETVKSPFQLSEGKNVT-VEMMYQIGTFKLAFVKEPQMQVLELPYVNNKLSMIILLPVGIAN 255

  Fly   252 CKDILDNLNNQINVEYND-----HKDVHLLLPIFKEKFDYNIAKFFNGINIEDTFKDSAFKSKAK 311
            .|.|...||:....|:..     .::|.:.||.||.:..|.:......:.:.|.|      ::.|
Human   256 LKQIEKQLNSGTFHEWTSSSNMMEREVEVHLPRFKLETKYELNSLLKSLGVTDLF------NQVK 314

  Fly   312 IKINNFRVNHGIRFQPILRLEVVDDIDTGKTET------------------FEVNRPFVFVIK 356
            ..::......|:.....:....:|..:.| ||.                  |:.|.||:|.|:
Human   315 ADLSGMSPTKGLYLSKAIHKSYLDVSEEG-TEAAAATGDSIAVKSLPMRAQFKANHPFLFFIR 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp76ANP_524153.1 SERPIN 22..367 CDD:294093 76/388 (20%)
SERPINB11NP_001357404.1 ovalbumin_like 4..392 CDD:239014 76/388 (20%)
RCL. /evidence=ECO:0000250 341..365 3/24 (13%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.