DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp76A and SERPINB12

DIOPT Version :9

Sequence 1:NP_524153.1 Gene:Acp76A / 40078 FlyBaseID:FBgn0015586 Length:388 Species:Drosophila melanogaster
Sequence 2:XP_005266835.2 Gene:SERPINB12 / 89777 HGNCID:14220 Length:437 Species:Homo sapiens


Alignment Length:441 Identity:85/441 - (19%)
Similarity:152/441 - (34%) Gaps:114/441 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 QVIFLVLCTSLLFQNTIQQNVSFQLIREI---DRYTPENFVLSVLNIEMILFEIHAAKAVESNND 66
            |::......||:..||   ...|.|.:||   ||:  :|...|.|::...|..:......:|.:.
Human     6 QIVISFTMDSLVTANT---KFCFDLFQEIGKDDRH--KNIFFSPLSLSAALGMVRLGARSDSAHQ 65

  Fly    67 LERSLIIN-FGYSEARQ-------------------------EVLD----------------WGL 89
            ::..|..| |..:|:::                         |.||                :|.
Human    66 IDEVLHFNEFSQNESKEPDPCLKSNKQKVLADSSLEGQKKTTEPLDQQAGSLNNESGLVSCYFGQ 130

  Fly    90 RYKKASSAK----FQMANKVAVSQKLPLSQK-LRLVNEVLMTSAKKYDVTKDVRPSKLMDE---W 146
            ...|....|    ..:||::...|:.|:.|: |..|.:...|:.:..|..|:  |.|...|   |
Human   131 LLSKLDRIKTDYTLSIANRLYGEQEFPICQEYLDGVIQFYHTTIESVDFQKN--PEKSRQEINFW 193

  Fly   147 LSSHLDGVLANFVQEKKLNAGENIVAISGMTVTPLWASHFQSE--INRYFVNNPGTGYASKDPTC 209
            :.....|.:.....:..:||...:|.::.:.....|.::|..|  ::..|..|      :.:...
Human   194 VECQSQGKIKELFSKDAINAETVLVLVNAVYFKAKWETYFDHENTVDAPFCLN------ANENKS 252

  Fly   210 VPMMHSLSSFETMSTDEAKG--IYIPFSSANLGMLILLPRKGVTCKDILDNLNNQI--------- 263
            |.||.....:.....:|.|.  :.:.::...|.|.:|||.........|:.|..:|         
Human   253 VKMMTQKGLYRIGFIEEVKAQILEMRYTKGKLSMFVLLPSHSKDNLKGLEELERKITYEKMVAWS 317

  Fly   264 NVEYNDHKDVHLLLPIFKEKFDYNIAKFFNGINIEDTFKDSAFKSKAKIKINNFRVNHGIRFQPI 328
            :.|....:.|.|..|.|..:..|::......:.|.|.|.:    ::|.:.        ||...|.
Human   318 SSENMSEESVVLSFPRFTLEDSYDLNSILQDMGITDIFDE----TRADLT--------GISPSPN 370

  Fly   329 LRLEVV-----DDIDTGKTET------------------FEVNRPFVFVIK 356
            |.|..:     .::|...|:.                  |..|.||:|.|:
Human   371 LYLSKIIHKTFVEVDENGTQAAAATGAVVSERSLRSWVEFNANHPFLFFIR 421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp76ANP_524153.1 SERPIN 22..367 CDD:294093 80/424 (19%)
SERPINB12XP_005266835.2 ovalbumin_like 16..437 CDD:239014 83/431 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.