DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp76A and AT2G26390

DIOPT Version :9

Sequence 1:NP_524153.1 Gene:Acp76A / 40078 FlyBaseID:FBgn0015586 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_180207.1 Gene:AT2G26390 / 817179 AraportID:AT2G26390 Length:389 Species:Arabidopsis thaliana


Alignment Length:399 Identity:76/399 - (19%)
Similarity:141/399 - (35%) Gaps:100/399 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 QQNVSFQLIR---EIDRYTPENFVLSVLNIEMILFEIHAAKAVESNNDLERSLIINFGYSEARQ- 82
            |.||..:|.:   |.|.....|.|.|.::|.::|..|.|     .:|.:.:..|::|..|.:.. 
plant    10 QNNVVARLAKKVIETDVANGSNVVFSPMSINVLLSLIAA-----GSNPVTKEEILSFLMSPSTDH 69

  Fly    83 ------EVLDWGLRYKKASSAKFQMANKVAVSQKLPLSQKLR-LVNEVLMTSAKKYDVTKDVRPS 140
                  ::.|.|   .:.|......|:.|.:.:...|....: |:......|..:.|..  .:|.
plant    70 LNAVLAKIADGG---TERSDLCLSTAHGVWIDKSSYLKPSFKELLENSYKASCSQVDFA--TKPV 129

  Fly   141 KLMDE---WLSSHLDGVLANFVQEKKLNAGENIVAISGMTVTPLWASHFQSEINRYFVNNPGTGY 202
            :::||   |...|.:|::...:..   :..:.|..|...|:....|.:|::..:|.|     ...
plant   130 EVIDEVNIWADVHTNGLIKQILSR---DCTDTIKEIRNSTLILANAVYFKAAWSRKF-----DAK 186

  Fly   203 ASKD---------PTCVPMMHSLSSFETMSTDEAKGIYIPF--SSANLGMLILLPRKGVTCKDIL 256
            .:||         ...||.|.|.........|..:.:.:|:  ...:..|.|.||..    ||.|
plant   187 LTKDNDFHLLDGNTVKVPFMMSYKDQYLRGYDGFQVLRLPYVEDKRHFSMYIYLPND----KDGL 247

  Fly   257 DNLNNQINVE---YNDHKDVH------LLLPIFKEKFDYNIAKFFNGINIEDTFKDSAFKSKAKI 312
            ..|..:|:.|   .:.|..:|      |.:|.....|::..::.     ::|....|.|.||..:
plant   248 AALLEKISTEPGFLDSHIPLHRTPVDALRIPKLNFSFEFKASEV-----LKDMGLTSPFTSKGNL 307

  Fly   313 -----------KINNFRVNHGIRFQPILRLEVVDDIDTGKTET------------------FEVN 348
                       |::...:.|          :...::|...||.                  |..:
plant   308 TEMVDSPSNGDKLHVSSIIH----------KACIEVDEEGTEAAAVSVAIMMPQCLMRNPDFVAD 362

  Fly   349 RPFVFVIKD 357
            .||:|.:::
plant   363 HPFLFTVRE 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp76ANP_524153.1 SERPIN 22..367 CDD:294093 76/399 (19%)
AT2G26390NP_180207.1 serpinP_plants 8..386 CDD:381001 76/399 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.