DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp76A and CCP3

DIOPT Version :9

Sequence 1:NP_524153.1 Gene:Acp76A / 40078 FlyBaseID:FBgn0015586 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_180096.3 Gene:CCP3 / 817062 AraportID:AT2G25240 Length:385 Species:Arabidopsis thaliana


Alignment Length:366 Identity:72/366 - (19%)
Similarity:142/366 - (38%) Gaps:67/366 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 NFVLSVLNIEMILFEIHAAKAVESNNDLERSLIINF-------GYSEARQEVLDWGLRYKKASSA 97
            |.|.|.::|.::|..|.|...     .:.:..|::|       ..:....:::|.|   .:.|..
plant    30 NLVFSPISINVLLSLIAAGSC-----SVTKEQILSFLMLPSTDHLNLVLAQIIDGG---TEKSDL 86

  Fly    98 KFQMANKVAVSQ--KLPLSQKLRLVNEVLMTSAKKYDVTKDVRPSKLMDE---WLSSHLDGVLAN 157
            :..:||.|.:.:  .|.||.|..|.|....|.::   |....:||:::||   |...|.:|::..
plant    87 RLSIANGVWIDKFFSLKLSFKDLLENSYKATCSQ---VDFASKPSEVIDEVNTWAEVHTNGLIKQ 148

  Fly   158 FVQEKKLNA--GENIVAISGMTVTPLWASHFQSEINRY--FVNNPGTGYASKDPTCVPMMHSLSS 218
            .:....::.  ...:|..:.:.....|:|.|.:.:.:.  |....||...      ||.|.:...
plant   149 ILSRDSIDTIRSSTLVLANAVYFKGAWSSKFDANMTKKNDFHLLDGTSVK------VPFMTNYED 207

  Fly   219 FETMSTDEAKGIYIPF--SSANLGMLILLPRKGVTCKDILDNLNNQINVEYNDHKDVHLL----- 276
            ....|.|..|.:.:|:  ......|.|.||........:|:.:.::.:. :::|..:|.:     
plant   208 QYLRSYDGFKVLRLPYIEDQRQFSMYIYLPNDKEGLAPLLEKIGSEPSF-FDNHIPLHCISVGAF 271

  Fly   277 -LPIFKEKFDYNIAKFFNGINIEDTFKD-------------------SAFKSKAKIKINNFRVNH 321
             :|.||..|::|.::....:.:...|.:                   |:...||.|:::    ..
plant   272 RIPKFKFSFEFNASEVLKDMGLTSPFNNGGGLTEMVDSPSNGDDLYVSSILHKACIEVD----EE 332

  Fly   322 GIRFQPILRLEVVDDIDTGKTETFEVNRPFVFVIK-DKINV 361
            |.....: .:.||......:...|..:|||:|.:: ||..|
plant   333 GTEAAAV-SVGVVSCTSFRRNPDFVADRPFLFTVREDKSGV 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp76ANP_524153.1 SERPIN 22..367 CDD:294093 72/366 (20%)
CCP3NP_180096.3 plant_SERPIN 8..382 CDD:238998 72/366 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.