DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp76A and SRP2

DIOPT Version :9

Sequence 1:NP_524153.1 Gene:Acp76A / 40078 FlyBaseID:FBgn0015586 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_179060.1 Gene:SRP2 / 815941 AraportID:AT2G14540 Length:407 Species:Arabidopsis thaliana


Alignment Length:382 Identity:76/382 - (19%)
Similarity:136/382 - (35%) Gaps:83/382 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 QQNVSFQLIREIDRYTPE--NFVLSVLNIEMILFEIHAAKAVESNNDLERSLIINFGYSEARQEV 84
            |..||..|:.::.....:  |.|.|..:|..:|    ...|..::|...||.|::|..|.:.:|.
plant    38 QNEVSLLLVGKVISAVAKNSNCVFSPASINAVL----TVTAANTDNKTLRSFILSFLKSSSTEET 98

  Fly    85 LDWGLRYKKASSAKFQMAN-----KVAVSQKLPLSQKLR-------LVNEVLMTSAKKYDVTKDV 137
               ...:.:.:|..|:..:     |:|....:.:.|.|.       |.......|..|.|.....
plant    99 ---NAIFHELASVVFKDGSETGGPKIAAVNGVWMEQSLSCNPDWEDLFLNFFKASFAKVDFRHKA 160

  Fly   138 RPSKL-MDEWLSSHLDGVLANFVQEKKLNAGENIVAISGMTVTPLWASHFQSEINR----YFVNN 197
            ...:| ::.|.|.|.:.::...:....:.:..|.:..:.:.....|...|...:.|    :.:|.
plant   161 EEVRLDVNTWASRHTNDLIKEILPRGSVTSLTNWIYGNALYFKGAWEKAFDKSMTRDKPFHLLNG 225

  Fly   198 PGTGYASKDPTCVPMMHSLSSFETMSTDEAKGIYIPF------SSANLGMLILLPRKGVTCKDIL 256
            ....        ||.|.|.......:.|..|.:.:|:      ::....|.:.||.|    |..|
plant   226 KSVS--------VPFMRSYEKQFIEAYDGFKVLRLPYRQGRDDTNREFSMYLYLPDK----KGEL 278

  Fly   257 DNLNNQI--------------NVEYNDHKDVHLLLPIFKEKFDYNIAKFFNGINIEDTFKDSAFK 307
            |||..:|              .|:..|.:     :|.||.:|.:..:..||...:     :.:..
plant   279 DNLLERITSNPGFLDSHIPEYRVDVGDFR-----IPKFKIEFGFEASSVFNDFEL-----NVSLH 333

  Fly   308 SKAKIKINNFRVNHGIRFQPILRLEVVDDIDTG-------KTETFEVNRPFVFVIKD 357
            .||.|:|:    ..|........:.||    ||       |...|..:.||:|:|::
plant   334 QKALIEID----EEGTEAAAATTVVVV----TGSCLWEPKKKIDFVADHPFLFLIRE 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp76ANP_524153.1 SERPIN 22..367 CDD:294093 76/382 (20%)
SRP2NP_179060.1 SERPIN 36..397 CDD:294093 76/382 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.