DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp76A and Serpinb1a

DIOPT Version :9

Sequence 1:NP_524153.1 Gene:Acp76A / 40078 FlyBaseID:FBgn0015586 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_079705.2 Gene:Serpinb1a / 66222 MGIID:1913472 Length:379 Species:Mus musculus


Alignment Length:403 Identity:81/403 - (20%)
Similarity:155/403 - (38%) Gaps:88/403 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 NTIQQNVSFQLIREIDRYTPENFVLSVLNIEMILFEIHAAKAVESNNDLERSLIINFGYSEARQE 83
            ||:   .:.:|.:.::..:|..      ||....|.|.:|.|:         :|:....|.|.|.
Mouse     8 NTL---FALELFQTLNESSPTG------NIFFSPFSISSALAM---------VILGAKGSTAAQL 54

  Fly    84 VLDWGLRYKKASSAKFQMAN----KVAVSQKLPLSQKL------RLVNEVLMTSAKKY------- 131
            ...:.....:...::||..|    |...|..|.|:.:|      ..:.|.|.::.|.|       
Mouse    55 SKTFHFDSVEDIHSRFQSLNAEVSKRGASHTLKLANRLYGEKTYNFLPEYLASTQKMYGADLAPV 119

  Fly   132 ---DVTKDVRPSKLMDEWLSSHLDGVLANFVQEKKLNAGENIVAISGMTVTPLWASHFQSEINRY 193
               ..::|.|  |.:::|:....:|.:...:....:::...:|.::.:....:|...|.:|    
Mouse   120 DFLHASEDAR--KEINQWVKGQTEGKIPELLSVGVVDSMTKLVLVNAIYFKGMWEEKFMTE---- 178

  Fly   194 FVNNPGTGYASKDPTCVPMMHSLSSFE--TMSTDEAKGIYIPFSSANLGMLILLPR--------- 247
            ...:.....:.||...|.||:....|.  .:|..:.|.:.:|:....|.|:||||:         
Mouse   179 DTTDAPFRLSKKDTKTVKMMYQKKKFPFGYISDLKCKVLEMPYQGGELSMVILLPKDIEDESTGL 243

  Fly   248 ----KGVTCKDILDNLNNQINVEYNDHKDVHLLLPIFKEKFDYNIAKFFNGINIEDTFKDSAFKS 308
                |.:|.:.:|:....: |:|:   .|||:.||.||.:..|.:......:.::|.|      |
Mouse   244 KKIEKQITLEKLLEWTKRE-NLEF---IDVHVKLPRFKIEESYTLNSNLGRLGVQDLF------S 298

  Fly   309 KAKIKINNFRVNHGIRFQPILRLEVVDDIDTG-----------------KTETFEVNRPFVFVIK 356
            .:|..::....:..:....|:....|:..:.|                 ..|.|.|:.||:|.|:
Mouse   299 SSKADLSGMSGSRDLFISKIVHKSFVEVNEEGTEAAAATGGIATFCMLLPEEEFTVDHPFIFFIR 363

  Fly   357 DK--INVYAVGRI 367
            ..  .||..:||:
Mouse   364 HNPTSNVLFLGRV 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp76ANP_524153.1 SERPIN 22..367 CDD:294093 78/398 (20%)
Serpinb1aNP_079705.2 serpinB1_LEI 1..379 CDD:381028 81/403 (20%)
CARD-binding motif (CBM). /evidence=ECO:0000250|UniProtKB:P30740 351..379 10/26 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.