DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp76A and SERPINB13

DIOPT Version :9

Sequence 1:NP_524153.1 Gene:Acp76A / 40078 FlyBaseID:FBgn0015586 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_001294852.1 Gene:SERPINB13 / 5275 HGNCID:8944 Length:400 Species:Homo sapiens


Alignment Length:416 Identity:79/416 - (18%)
Similarity:150/416 - (36%) Gaps:90/416 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 IQQNVSFQLIREIDRYTPENFVLSVLN----IEMILFEIHAAKAVE------SNNDLERSLIINF 75
            :...:.|.|.:|:.:....|...|.:.    |.|:|.....|.|.:      |..:.:.|.|   
Human     7 VSTRLGFDLFKELKKTNDGNIFFSPVGILTAIGMVLLGTRGATASQLEEVFHSEKETKSSRI--- 68

  Fly    76 GYSEARQEVLDWGLRYKKASSAKFQMANKVAVSQ----------KLPLSQKLRLVNEVL------ 124
              ....:||    :|.|....   ::.|..||.|          ||....:|.:.|.:.      
Human    69 --KAEEKEV----VRIKAEGK---EIENTEAVHQQFQKFLTEISKLTNDYELNITNRLFGEKTYL 124

  Fly   125 -----MTSAKKY--------DVTKDVRPS-KLMDEWLSSHLDGVLANFVQEKKLNAGENIVAISG 175
                 :...:||        |.......| |.::.|:.|..:..:.:...:..:::...:|.::.
Human   125 FLQKYLDYVEKYYHASLEPVDFVNAADESRKKINSWVESKTNEKIKDLFPDGSISSSTKLVLVNM 189

  Fly   176 MTVTPLWASHFQSE---INRYFVNNPGTGYASKDPTCVPMMHSLSSFETMSTDEAKGIYIPFSSA 237
            :.....|...|:.|   ..::::|..    .||....:...||. ||..:...:||.:.||:.:.
Human   190 VYFKGQWDREFKKENTKEEKFWMNKS----TSKSVQMMTQSHSF-SFTFLEDLQAKILGIPYKNN 249

  Fly   238 NLGMLILLPRKGVTCKDILDNLNNQINVEYN-----DHKDVHLLLPIFKEKFDYNIAKFFNGINI 297
            :|.|.:|||......:.|:|.::.:..||:.     :.:.|:|.||.|:.:..|::......:.:
Human   250 DLSMFVLLPNDIDGLEKIIDKISPEKLVEWTSPGHMEERKVNLHLPRFEVEDGYDLEAVLAAMGM 314

  Fly   298 EDTFKDSAFKSKAKIKINNFRVNHGIRFQPILRLEVVDDIDTGKT-----------------ETF 345
            .|.|      |:.|...:......|:..|..|....|...:.|..                 |..
Human   315 GDAF------SEHKADYSGMSSGSGLYAQKFLHSSFVAVTEEGTEAAAATGIGFTVTSAPGHENV 373

  Fly   346 EVNRPFVFVIK--DKINVYAVGRIEN 369
            ..|.||:|.|:  :..::...||..:
Human   374 HCNHPFLFFIRHNESNSILFFGRFSS 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp76ANP_524153.1 SERPIN 22..367 CDD:294093 78/411 (19%)
SERPINB13NP_001294852.1 SERPIN 4..400 CDD:294093 79/416 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.