DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp76A and SERPINI1

DIOPT Version :9

Sequence 1:NP_524153.1 Gene:Acp76A / 40078 FlyBaseID:FBgn0015586 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_001116224.1 Gene:SERPINI1 / 5274 HGNCID:8943 Length:410 Species:Homo sapiens


Alignment Length:381 Identity:75/381 - (19%)
Similarity:151/381 - (39%) Gaps:82/381 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 ENFVLSVLNIEMILFEIHAAKAVESNNDLERSLIINFGYSEARQ-EVLDWGLRYKKASSAK---- 98
            ||.:.|.|:|.:.:..:.......:..::..|:    ||...:. |...:...:....:||    
Human    44 ENILFSPLSIALAMGMMELGAQGSTQKEIRHSM----GYDSLKNGEEFSFLKEFSNMVTAKESQY 104

  Fly    99 -FQMANKVAVSQKLPLSQKLRLVNEVLMTSAKKY--------DVTKDVRPSKLMDEWLSSHLDGV 154
             .::||.:.|.....       |||..:...|||        |.:::|..:..:::|:.::.:.:
Human   105 VMKIANSLFVQNGFH-------VNEEFLQMMKKYFNAAVNHVDFSQNVAVANYINKWVENNTNNL 162

  Fly   155 LANFVQEKKLNAGENIVAISGMTVTPLWASHFQSEINRYFVNNPGTGYASKDPT--CVPMMHSLS 217
            :.:.|..:..:|...:..|:.:.....|.|.|:.|..|.|      .:...|.:  .:|||:...
Human   163 VKDLVSPRDFDAATYLALINAVYFKGNWKSQFRPENTRTF------SFTKDDESEVQIPMMYQQG 221

  Fly   218 SFE----TMSTDEAKGIY----IPFSSANLGMLILLPRKGVTCKDILDNLNNQINVEYND---HK 271
            .|.    :..::||.|||    ||:....:.|:::|.|:.|....:...:..|:..|:.:   .:
Human   222 EFYYGEFSDGSNEAGGIYQVLEIPYEGDEISMMLVLSRQEVPLATLEPLVKAQLVEEWANSVKKQ 286

  Fly   272 DVHLLLPIFKEKFDYNIAKFFNGINIEDTF-KDS----------AFKSKAKIKINNFRVNH---- 321
            .|.:.||.|..:.:.::......:.|.:.| ||:          .|.||| |..:...||.    
Human   287 KVEVYLPRFTVEQEIDLKDVLKALGITEIFIKDANLTGLSDNKEIFLSKA-IHKSFLEVNEEGSE 350

  Fly   322 --------GIRFQPILRLEVVDDIDTGKTETFEVNRPFVFVIKDKI--NVYAVGRI 367
                    .|....:|..:|:            |:.||.|:|:::.  .:..:||:
Human   351 AAAVSGMIAISRMAVLYPQVI------------VDHPFFFLIRNRRTGTILFMGRV 394

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp76ANP_524153.1 SERPIN 22..367 CDD:294093 74/379 (20%)
SERPINI1NP_001116224.1 neuroserpin 23..410 CDD:239003 75/381 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.