DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp76A and SERPINB2

DIOPT Version :9

Sequence 1:NP_524153.1 Gene:Acp76A / 40078 FlyBaseID:FBgn0015586 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_001137290.1 Gene:SERPINB2 / 5055 HGNCID:8584 Length:415 Species:Homo sapiens


Alignment Length:380 Identity:72/380 - (18%)
Similarity:146/380 - (38%) Gaps:84/380 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 TPENFVLSVLNIEMI--------LFEIHAAKAVESNNDLERSL--IINFGYSEARQEVLDWGLRY 91
            |||||. |...::.|        :.:..||..:.|:   .|||  .||                 
Human    72 TPENFT-SCGFMQQIQKGSYPDAILQAQAADKIHSS---FRSLSSAIN----------------- 115

  Fly    92 KKASSAKF--QMANKVAVSQKLPLSQK-LRLVNEVLMTSAKKYDVTKDVRPS-KLMDEWLSSHLD 152
              ||:..:  :..||:...:.....:: :||..:...:..:..|..:....: |.::.|:.:...
Human   116 --ASTGNYLLESVNKLFGEKSASFREEYIRLCQKYYSSEPQAVDFLECAEEARKKINSWVKTQTK 178

  Fly   153 GVLANFVQEKKLNAGENIVAISGMTVTPLWASHFQSEINRYF---VNNPGTGYASKDPTCVPMMH 214
            |.:.|.:.|..::....:|.::.:.....|.:.|:.::|..:   ||:     |.:.|  |.||:
Human   179 GKIPNLLPEGSVDGDTRMVLVNAVYFKGKWKTPFEKKLNGLYPFRVNS-----AQRTP--VQMMY 236

  Fly   215 SLSSFETMSTDEAKG--IYIPFSSANLGMLILLPRKGV---TCKDIL------DNLNNQINVEYN 268
            ..........::.|.  :.:|: :.::.|.:|||.:..   |..::|      |.||...:.:..
Human   237 LREKLNIGYIEDLKAQILELPY-AGDVSMFLLLPDEIADVSTGLELLESEITYDKLNKWTSKDKM 300

  Fly   269 DHKDVHLLLPIFKEKFDYNIAKFFNGINIEDTFKDSAFKSKAKIKINNFRVNHGIRFQPILRLEV 333
            ...:|.:.:|.||.:..|.:......:.:||.|      :|.:...:.....:.:....:....:
Human   301 AEDEVEVYIPQFKLEEHYELRSILRSMGMEDAF------NKGRANFSGMSERNDLFLSEVFHQAM 359

  Fly   334 VD-------------DIDTGKT----ETFEVNRPFVFVIKDKIN--VYAVGRIEN 369
            ||             .:.||:|    ..|..:.||:|:|..||.  :...||..:
Human   360 VDVNEEGTEAAAGTGGVMTGRTGHGGPQFVADHPFLFLIMHKITNCILFFGRFSS 414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp76ANP_524153.1 SERPIN 22..367 CDD:294093 71/376 (19%)
SERPINB2NP_001137290.1 PAI-2 4..415 CDD:239013 72/380 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.