DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp76A and Serpinb3a

DIOPT Version :9

Sequence 1:NP_524153.1 Gene:Acp76A / 40078 FlyBaseID:FBgn0015586 Length:388 Species:Drosophila melanogaster
Sequence 2:XP_006249702.1 Gene:Serpinb3a / 498209 RGDID:1562868 Length:387 Species:Rattus norvegicus


Alignment Length:412 Identity:87/412 - (21%)
Similarity:157/412 - (38%) Gaps:86/412 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LFQNTIQQNVSFQLIREIDRYTPENFVLSVLNI--------------------EMILFEIHAAKA 60
            ||.....| .:.:|.|:: |.:.:|...|.|:|                    ::|.|.....|.
  Rat     3 LFAKATTQ-FTLELYRQL-RDSEDNIFYSPLSIMTALAMLQLGAKGNTEKQIEKVIQFHETTKKT 65

  Fly    61 VESNNDL--ERSLIINFGYSEARQEVLDWGLRYKKASSA-KFQMANKVAVSQKLPLSQK-LRLVN 121
            .|.:.|.  |.|:      .|..|:::   .:..|::.| ....||.:..::..|..|. |..:.
  Rat    66 TEKSADCHDEESV------HEQFQKLM---TQLNKSNDAYDLNSANSIYGAKHFPFLQTFLEDIK 121

  Fly   122 EVLMTSAKKYDVTKDVRPS-KLMDEWLSSHLDGVLANFVQEKKLNAGENIVAISGMTVTPLWASH 185
            |....:.:..|.......| |.::.|:.:..:|.:.:...:..||:...:|.::.:.....|...
  Rat   122 EYYQANVESLDFAHAAEESEKKINSWVENQTNGKIKDLFPKGSLNSSTILVLVNAVYFKGQWNHK 186

  Fly   186 F---QSEINRYFVNNPGTGYASKDPTCVPMMHSLSSFETMSTD--EAKGIYIPFSSANLGMLILL 245
            |   .:|.:::::|.    ..||.   |.||...:.|..:..:  :||.:.||:....|.|.|||
  Rat   187 FDEKHTEEDKFWLNK----NTSKP---VQMMRQKNEFNFIFLEDVQAKMVEIPYKGKELSMFILL 244

  Fly   246 PRKGVTCKDILDNLNNQI---------NVEYNDHKDVHLLLPIFKEKFDYNIAKFFNGINIEDTF 301
            |.:    .|.|..|..|:         ..|..:..|::|.||.||.:..|::......:.:.|  
  Rat   245 PME----IDGLKKLEEQLTADKLLEWTRAENMNMIDLYLSLPRFKVEEKYDLPGPLQHMGMVD-- 303

  Fly   302 KDSAFKSKAKIKINNFRVNHGIRFQPILRLEVVDDIDTGK-----------------TETFEVNR 349
               ||.|| |...:......|:....:|....|:..:.|.                 ||.|..:.
  Rat   304 ---AFDSK-KADFSGMSSTQGLMVSKVLHKSFVEVNEEGTEAAAATGVEVSLTSAQITEDFNCDH 364

  Fly   350 PFVFVIKDKI--NVYAVGRIEN 369
            ||:|:||...  ::...||:.:
  Rat   365 PFLFLIKHNATNSILFFGRMSS 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp76ANP_524153.1 SERPIN 22..367 CDD:294093 84/402 (21%)
Serpinb3aXP_006249702.1 SERPIN 5..387 CDD:294093 85/410 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.