DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp76A and Spn42Dd

DIOPT Version :9

Sequence 1:NP_524153.1 Gene:Acp76A / 40078 FlyBaseID:FBgn0015586 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_001163067.1 Gene:Spn42Dd / 49808 FlyBaseID:FBgn0028988 Length:372 Species:Drosophila melanogaster


Alignment Length:397 Identity:89/397 - (22%)
Similarity:165/397 - (41%) Gaps:69/397 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 IFLVLCTSLLFQNTIQQNVSFQLIREIDRYTPENFVLSVLNIEMILFEIHAAKAVESNNDLERSL 71
            |||.: ||:..|.:.:   .:||:.:  .:|.:|.|:|.::||.||..:.......:..:|:.:|
  Fly     6 IFLWV-TSVACQTSKE---IYQLLSK--SHTNQNLVVSPVSIETILSMVFMGAEGSTAKELQSAL 64

  Fly    72 IINFGYSEARQEVLDWGLRY--------KKASSAKFQMANKVAVSQKLPLSQKLRL-VNEVLMTS 127
            .:.   ||.::.|   ..||        .:......::||::.|:.:..|:|...| |.|...:.
  Fly    65 GLP---SEDKEAV---AARYGALLNDLQGQEEGPILKLANRIYVNDQYSLNQNYNLAVREPFKSE 123

  Fly   128 AKKYDVTKDVRPSKLMDEWLSSHLDGVLANFVQEKKLNAGENIVAISGMTVTPLWASHFQSEINR 192
            |:...:|.....::.:::|:.....|.:...:....:.:....:.::.:.....|.|.|      
  Fly   124 AESISLTNGPVAAERINQWVLDQTSGKIKGMIDPGSMTSDVKALLVNAIYFKGQWESKF------ 182

  Fly   193 YFVNNPGTGYAS------KDPTCVPMMHSLSSFET--MSTDEAKGIYIPFSSANLGMLILLPRKG 249
                :|....||      .....|.||..:.:|..  ....:|:.|.:|:.::||.|.|.|||: 
  Fly   183 ----DPAKTRASTFQVTANKSVPVQMMAQMGTFRANYFRDLDAQVIELPYLNSNLSMTIFLPRE- 242

  Fly   250 VTCKDILDNLNNQINVEYND---HKDVHLLLPIFKEKFDYNIAKFFNGINIEDTFKDSA-----F 306
               .:.|..|..:| |.:..   .|:|:|.||.||.:|...:.:....:.|.:.|.|.:     |
  Fly   243 ---VEGLSALEEKI-VGFARPLVAKEVYLKLPKFKIEFRDELKETLEKLGIRELFTDKSDLSGLF 303

  Fly   307 KSKAKIKINNFRVNHGIRFQPILRLEVVDDIDTGKTETFEVNR-----------PFVFVIKDKIN 360
            ..|:..|::  :|:|    :..|.:........|.|.....||           ||.|||:|...
  Fly   304 ADKSGGKVS--QVSH----KAFLEVNEEGAEAAGATSVAVTNRAGFSTFLMADHPFAFVIRDANT 362

  Fly   361 VYAVGRI 367
            :|..||:
  Fly   363 IYFQGRV 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp76ANP_524153.1 SERPIN 22..367 CDD:294093 82/380 (22%)
Spn42DdNP_001163067.1 SERPIN 16..369 CDD:238101 83/384 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.