DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp76A and Spn28F

DIOPT Version :9

Sequence 1:NP_524153.1 Gene:Acp76A / 40078 FlyBaseID:FBgn0015586 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_524957.2 Gene:Spn28F / 49807 FlyBaseID:FBgn0028987 Length:375 Species:Drosophila melanogaster


Alignment Length:403 Identity:88/403 - (21%)
Similarity:162/403 - (40%) Gaps:87/403 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LVLCTSL-------LFQNTIQQNVSFQLIREIDRYTPENFVLSVLNIEMILFEIHAAKAVESNND 66
            |:|.||:       .:|...::|.:            .|.:.|.|::|:.|...:.....::..:
  Fly     7 LLLATSVSCRFADDFYQLLAKENAA------------NNLISSPLSVEIALSMAYMGARAKTAQE 59

  Fly    67 LERSLIINFGYSEARQEVLDWGLRYKKASS--------AKFQMANKVAVSQKLPLSQKL-RLVNE 122
            :...|.:    .:.::||   ..:||...|        |...:||::.|::|..|.... ::|.:
  Fly    60 MRNVLKL----PDDKKEV---AAKYKDLLSKLEGREKVATLSLANRIYVNKKFQLVPSYNQMVKD 117

  Fly   123 VLMTSAKKYDVTKDVRPSKLMDEWLSSHLDGVLANFVQEKKLNAGENIVAISGMTVTPLWASHFQ 187
            ..|..|:..|:....:.|.:::.|:.:...|.:.:.|....::..| ::.::.:.....|...|.
  Fly   118 SFMAEAEAIDIVDPNKASSIVNNWVDNQTRGKIKDLVSSNDMSKME-LIVLNAIYFKGQWEYKFN 181

  Fly   188 SEINRYFVNNPGTGYASKDPTCVP--MMHSLSSFETMSTDE--AKGIYIPFSSANLGMLILLPRK 248
            .::.:      ...:...|...||  ||....||......|  ||.|.:|:.:::|.|||.||.:
  Fly   182 PKLTK------KRNFRVSDQKSVPVEMMSLFQSFRAAHDSELGAKIIELPYRNSSLSMLIFLPDQ 240

  Fly   249 GVTCKDILDNLNNQINVEYN---DHKDVHLLLPIFKEKFDYNIAKFFNGINIEDTFKDSA-FKS- 308
                .|.|..|..:| |.:.   ...||.|.||.||.:|...:.|....:.|:|.|:.|| ||. 
  Fly   241 ----VDGLSELEKKI-VGFKPKLSKMDVTLRLPKFKIEFFAQLNKVLVAMGIQDAFEKSADFKDL 300

  Fly   309 -------------KAKIKINNFRVNHG-------IRF-QPILRLEVVDDIDTGKTETFEVNRPFV 352
                         ||.|::|.......       :|: .|:...::|          |..:.||.
  Fly   301 VENSNVHVKKVIHKAFIEVNEEGAEAAAATALLFVRYSMPMPSSQMV----------FNADHPFA 355

  Fly   353 FVIKDKINVYAVG 365
            :||:|:..:|..|
  Fly   356 YVIRDRETIYFQG 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp76ANP_524153.1 SERPIN 22..367 CDD:294093 83/383 (22%)
Spn28FNP_524957.2 SERPIN 14..370 CDD:238101 84/396 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.