DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp76A and Spn42Da

DIOPT Version :9

Sequence 1:NP_524153.1 Gene:Acp76A / 40078 FlyBaseID:FBgn0015586 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_524955.2 Gene:Spn42Da / 49805 FlyBaseID:FBgn0265137 Length:424 Species:Drosophila melanogaster


Alignment Length:305 Identity:69/305 - (22%)
Similarity:129/305 - (42%) Gaps:39/305 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 ENFVLSVLNIEMILFEIHAAKA-VESNNDLERSLIINFGYSEARQEVLDWGLRYKKAS---SAKF 99
            ||.|.|..:|:..     ||.| :.:.|:....|....|.:.:..|.:........|:   |...
  Fly    63 ENIVFSPFSIQTC-----AAMARLGAENETATQLDQGLGLASSDPEQIAHSFHQVLAAYQDSQIL 122

  Fly   100 QMANKVAVSQKLPLSQKL-RLVNEVLMTSAKKYDVTKDVRPSKLMDEWLSSHLDGVLANFVQEKK 163
            ::|||:.|.....|.|:. :|:::..:::|:..|.:|:|:.:..::.|:....:.::.:.|....
  Fly   123 RIANKIFVMDGYQLRQEFDQLLSKQFLSAAQSVDFSKNVQAAATINNWVEQRTNHLIKDLVPADV 187

  Fly   164 LNAGENIVAISGMTVTPLWASHFQSEINRYFVNNPGTGYASKDPTC-VPMMHSLSSFE--TMSTD 225
            ||:...:|.::.:.....|...|...:.|     |.|.:...:.|. ||||.....|.  .:...
  Fly   188 LNSESRLVLVNAIHFKGTWQHQFAKHLTR-----PDTFHLDGERTVQVPMMSLKERFRYADLPAL 247

  Fly   226 EAKGIYIPFSSANLGMLILLPRKGVTCKDILDNLN----NQINVEYNDHKDVHLLLPIFKEKFDY 286
            :|..:.:|:..::|.|||:||........:.:.|.    :||.....:.| |.|.||.||.:|..
  Fly   248 DAMALELPYKDSDLSMLIVLPNTKTGLPALEEKLRLTTLSQITQSLYETK-VALKLPRFKAEFQV 311

  Fly   287 NIAKFFNGINIEDTFKD----------------SAFKSKAKIKIN 315
            .:::.|..:.:...|.|                ||...||.|::|
  Fly   312 ELSEVFQKLGMSRMFSDQAEFGKMLQSPEPLKVSAIIHKAFIEVN 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp76ANP_524153.1 SERPIN 22..367 CDD:294093 69/305 (23%)
Spn42DaNP_524955.2 SERPIN 45..408 CDD:238101 69/305 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.