DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp76A and Spn88Ea

DIOPT Version :9

Sequence 1:NP_524153.1 Gene:Acp76A / 40078 FlyBaseID:FBgn0015586 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_524954.2 Gene:Spn88Ea / 49804 FlyBaseID:FBgn0028984 Length:427 Species:Drosophila melanogaster


Alignment Length:404 Identity:78/404 - (19%)
Similarity:153/404 - (37%) Gaps:120/404 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 ENFVLSVLNI-------EMILFE----IHAAKAV--ESNNDLERSLIINFGYSEARQEVLDWGLR 90
            :||.:|:||:       |.:.|.    .||....  .|:.|.|:.|        |:...|||...
  Fly    41 QNFAVSMLNVIRQSTPNENVFFSPYSTYHALLLAYFGSSGDTEKEL--------AKVLHLDWADS 97

  Fly    91 YKKASSAK-FQMANKVAVSQKLPL----SQKLRLVNEVLMTSAKKYDVTKDVR----------PS 140
            .:...||. .:..|:.....|:||    :.::...|::.:|...:..:.::|:          ..
  Fly    98 KEVVRSAYILEKMNRKERQSKMPLEFSSADRIFFANDLHVTECARNRLAEEVQQIDFKSQTEESR 162

  Fly   141 KLMDEWLSSHLDGVLANFVQEKKLNAGENIVAISGMTVTPLWASHFQSE--INRYFVNNPGTGYA 203
            |.:::|::......:.|.:...::.....:|..:...:...|.|.|::|  :...|..:| :.| 
  Fly   163 KQINDWIAKQTHDQIRNMLSADEITPRTRLVLANAAYLKGQWLSQFKTEKTVPMPFYTSP-SNY- 225

  Fly   204 SKDPTCVPMMHSLSSFETMSTDE---AKGIYIPF---------------SSANLGMLILLPR-KG 249
                :.|.||....:| .::.||   |..:.:|:               .::::.|:::||. ..
  Fly   226 ----SLVSMMQQKGTF-LLNVDEQLRAHVLQLPYRTVFESQEKEDSSPDENSDISMVLILPPFNS 285

  Fly   250 VTCKDILDNLNNQI---NVEYNDHKDVHLLLPIFK-----------------EKFDYNIAKF--- 291
            .:.:|:|..||...   :::....:::.:.||.|:                 :.||.::|.|   
  Fly   286 NSLEDVLSRLNADSLDDSLKQAMPREIEVSLPKFEFEQRLELNPILAKMGVSKMFDESVATFDDL 350

  Fly   292 -FNGINIEDTFKDSAFKSKAKIKINN-----------FRVNHGIRFQPILRLEVVDDIDTGKTET 344
             ...|:|.|:      |..||||::.           |........:|               ..
  Fly   351 TSETISIGDS------KHVAKIKVDEEGSTAAAATVLFTYRSARPVEP---------------AK 394

  Fly   345 FEVNRPFVFVIKDK 358
            ||.|.||:|||.|:
  Fly   395 FECNHPFLFVIYDR 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp76ANP_524153.1 SERPIN 22..367 CDD:294093 78/404 (19%)
Spn88EaNP_524954.2 SERPIN 39..419 CDD:238101 78/404 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.