DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp76A and nec

DIOPT Version :9

Sequence 1:NP_524153.1 Gene:Acp76A / 40078 FlyBaseID:FBgn0015586 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_524851.1 Gene:nec / 45908 FlyBaseID:FBgn0002930 Length:476 Species:Drosophila melanogaster


Alignment Length:393 Identity:69/393 - (17%)
Similarity:145/393 - (36%) Gaps:84/393 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 SFQLIREIDR-YTPENFVLSVLNIEMILFEIHAAKAVESNNDLERSLIINFGYSEARQEVLDWGL 89
            |.:|.:||.: .:.:|.|.|..::..:|..|:.|...::..:|:::...:.......|: .:..:
  Fly   111 SSELFKEIIKSQSQQNVVFSPFSVHALLALIYGASDGKTFRELQKAGEFSKNAMAVAQD-FESVI 174

  Fly    90 RYKK-ASSAKFQMANKVAVSQKLPLSQKLRLVNEVLMTSAKKY--------DVTKDVRPSKLMDE 145
            :||| ...|...:|.||.      .:::|..||......||.|        |:......:..::.
  Fly   175 KYKKHLEGADLTLATKVY------YNRELGGVNHSYDEYAKFYFSAGTEAVDMQNAKDTAAKINA 233

  Fly   146 WLSSHLDGVLANFVQEKKLNAGENIVAISGMTVTPLWASHFQSEINRYFVNNPGTGYASKDPTCV 210
            |:.......:.:.|....::.....:.::.:.....|...|                |:.|.:..
  Fly   234 WVMDTTRNKIRDLVTPTDVDPQTQALLVNAVYFQGRWEHEF----------------ATMDTSPY 282

  Fly   211 PMMHS---LSSFETMSTDEAKG-----------IYIPFSSANLGMLILLPRKGVTCKDILDNLNN 261
            ...|:   :|....|..|:..|           :.:.:..:...||||||.:......:|..|:.
  Fly   283 DFQHTNGRISKVAMMFNDDVYGLAELPELGATALELAYKDSATSMLILLPNETTGLGKMLQQLSR 347

  Fly   262 QINVEYNDHKDVHLL--------LPIFKEKFDYNIAKFFNGINIEDTFKDSAFKSKAKIKINNFR 318
            .   |::.::..|.|        ||.|:.:|:.::.:....:.:...|..::..:|.        
  Fly   348 P---EFDLNRVAHRLRRQSVAVRLPKFQFEFEQDMTEPLKNLGVHQMFTPNSQVTKL-------- 401

  Fly   319 VNHGIRFQPILRLEVVDDIDTG------------------KTETFEVNRPFVFVIKDKINVYAVG 365
            ::..:|...||:...::..:.|                  |...|..||||||.::...:|..:|
  Fly   402 MDQPVRVSKILQKAYINVGEAGTEASAASYAKFVPLSLPPKPTEFVANRPFVFAVRTPASVLFIG 466

  Fly   366 RIE 368
            .:|
  Fly   467 HVE 469

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp76ANP_524153.1 SERPIN 22..367 CDD:294093 68/390 (17%)
necNP_524851.1 SERPIN 108..468 CDD:238101 68/390 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.