DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp76A and Spn43Ab

DIOPT Version :9

Sequence 1:NP_524153.1 Gene:Acp76A / 40078 FlyBaseID:FBgn0015586 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_001027395.1 Gene:Spn43Ab / 45040 FlyBaseID:FBgn0024293 Length:393 Species:Drosophila melanogaster


Alignment Length:406 Identity:84/406 - (20%)
Similarity:173/406 - (42%) Gaps:64/406 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LVLCTSLLFQNTIQQNVSFQLIREIDR--------------YTPENFVLSVLNIEMILFEIHAAK 59
            :::...||...|:.|:.:.......||              :..||.|:|...|:..:.......
  Fly     3 VIISCLLLLLATVSQSKTVGYDAAADRNLLAADLYNAVAADHLNENVVISPATIQSSMALAFVGA 67

  Fly    60 AVESNNDLERSLIINFGYSEARQEVLDWGLRYKKASSA--KFQMANKVAVSQKLPLSQKLRLVNE 122
            ..::.::|::.|.:..|.::|   |......|::|.:.  .|::||.:.:::.|......|.|  
  Fly    68 KGQTASELQQGLRLGPGDADA---VSQRSGSYQQALTRDNNFRLANNIYINENLEFKGSFRDV-- 127

  Fly   123 VLMTSAKKYDVTKD---------VRPSKLMDEWLSSHLDGVLANFVQEKKLNAGENIVAISGMTV 178
                :.:::|...|         .|.:..::..:::..:|.:.:.::.:.||.....|.::|::.
  Fly   128 ----AQRQFDSNIDKLDFHPPYNKRTADGINRAVATKTNGKITDILRAELLNDRTEGVIVNGVSY 188

  Fly   179 TPLWASHFQSEINRYFVNNPGTGYASKDPTCVPMMHSLSSF---ETMSTDEAKGIYIPFSSANLG 240
            :..|...|:.:.........|:|.:.|    |..|.:|.:|   |..|.| ||.:.:|:.:.:..
  Fly   189 SAAWQKAFRLDKTEKRSFRTGSGQSVK----VDTMWTLQNFNYAEVNSLD-AKVVELPYQNPDFS 248

  Fly   241 MLILLPRKGVTCKDILDNLNNQIN-------VEYNDHKDVHLLLPIFKEKFDYNIAKFFNGINIE 298
            ||:|||.:    ||.|.:|...::       :.....:.|.:|||.|...|...:...|..:.:.
  Fly   249 MLLLLPNR----KDGLRSLQQSLSGKNLLAEIGAMSQQKVEVLLPKFSVTFGLGLEGPFKKLGVH 309

  Fly   299 DTF-KDSAFKSKAKIKINNF--RVNHGIRFQPILRLEVVDDIDTG-------KTETFEVNRPFVF 353
            ..| :|..|.:..::.:::|  .|.|....: :....|...::||       :::.||.:.||||
  Fly   310 TMFSRDGDFGNMYRMFVSHFINAVEHKANVE-VTEAGVDQPLETGLLKGLFSRSKKFEADHPFVF 373

  Fly   354 VIKDKINVYAVGRIEN 369
            .||.|.::..:|.|.|
  Fly   374 AIKYKDSIAFIGHIAN 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp76ANP_524153.1 SERPIN 22..367 CDD:294093 79/389 (20%)
Spn43AbNP_001027395.1 SERPIN 30..387 CDD:238101 76/375 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.