DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp76A and Spn100A

DIOPT Version :9

Sequence 1:NP_524153.1 Gene:Acp76A / 40078 FlyBaseID:FBgn0015586 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_651818.1 Gene:Spn100A / 43642 FlyBaseID:FBgn0039795 Length:649 Species:Drosophila melanogaster


Alignment Length:447 Identity:92/447 - (20%)
Similarity:160/447 - (35%) Gaps:130/447 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LFQNTIQQNVSFQLIREIDRYTPENFVLSVLNIE---MILFEIHAAKAVESNNDLERSLIINFGY 77
            |.|...:|..:.:  .|::....|...|||...|   |...|..|.|.....:|.|.|.|.|...
  Fly   243 LLQKEQKQQATTE--SELESQPEETTTLSVEKQEKPDMAAEENPAEKQQNKRSDQEESQIKNLEE 305

  Fly    78 SEARQEVLDWGLRYKKASSAKFQMANKVAVSQ----KLPLSQKLRLVNEVLMTSAKKYDVTKDVR 138
            :|..||         :...||...|..:...:    :||| |||   ...:.|:||  |...::.
  Fly   306 NETVQE---------EEKLAKIMAAPALTAGEPEKVRLPL-QKL---ENAVKTAAK--DGADEIM 355

  Fly   139 PSKLMDEWLSSHLDGV-------------------LANFVQEKKLNAGENIVAISGMTVTPLWAS 184
            .:      |.|||..|                   .||.:..:...:...::..:|:.....||:
  Fly   356 LA------LESHLPSVSRVNGARSLFQQDDITSALSANSITGRSAGSKSKMLLFNGLYYRGSWAN 414

  Fly   185 HF----QSEINRYFVNNPGTGYASKDPTCVPMMHSLSSFETMSTDEAKG--IYIPFSSANLGMLI 243
            .|    ......:|:.|       :|....||||:...|:.....:.|.  :.:|:.::...:.|
  Fly   415 PFYQLRDGSDEFFFMTN-------EDAVKAPMMHARGKFQVADLPQVKARVLSLPYETSRYALCI 472

  Fly   244 LLPRKGVTCKDILDNLNNQ---INVEYNDHKDVHLLLPIFKEKFDYNIAKFFNGINIEDTFKDSA 305
            :||.:.....|::..|...   :..:....|::|:.:|.|:               :|:|.:..|
  Fly   473 VLPDETEGLSDVISQLQTSDFLLAKKQFQMKELHISMPKFQ---------------VEETSRSEA 522

  Fly   306 F-----------KSKAK---------------IKINNFRVNHG---------IRFQ---PILRLE 332
            .           :::|:               ::..|.||:.|         ...|   |.:...
  Fly   523 MLKQMGLKKVFSRTEAQLSLLSEDPDVHVDEIVQFVNVRVDEGGSSANSLSAATMQARTPSVEST 587

  Fly   333 VV----DDIDTGKTETFEVNRPFVFVIKD--KINVYAVGRI------ENLDGLTDKV 377
            |:    .:.:....|.|||||||.:.|.|  :..|.|.|:|      |:|..::.:|
  Fly   588 VLPVPEPEPELPGVERFEVNRPFAYFIVDCQEQFVLASGKIYTPEFKEDLPSVSIEV 644

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp76ANP_524153.1 SERPIN 22..367 CDD:294093 86/423 (20%)
Spn100ANP_651818.1 SERPIN 41..>148 CDD:294093
SERPIN <380..628 CDD:294093 49/269 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.