DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp76A and Serpinb6e

DIOPT Version :9

Sequence 1:NP_524153.1 Gene:Acp76A / 40078 FlyBaseID:FBgn0015586 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_001039000.2 Gene:Serpinb6e / 435350 MGIID:2667778 Length:429 Species:Mus musculus


Alignment Length:438 Identity:83/438 - (18%)
Similarity:166/438 - (37%) Gaps:92/438 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 IFLVLCTSLLFQNTIQQNVS------------FQLIREI--DRYTPENFVLS-----VLNIEMIL 52
            ::...|..|||..: :.||.            |.::..|  .|||..:.:|.     .|.:..:|
Mouse     8 LYFPCCICLLFTKS-EHNVGESENSGYILDCVFIMLIVILHSRYTIMDSLLEANATFTLKLFRVL 71

  Fly    53 FEIHAAKAVESNNDLERSL-IINFGYSEARQEVLDWGLRYKKASS--AKFQMANKVAVSQ--KLP 112
            .|..:.....|::.:..|| :|..|.:......:...|...|.|:  |..|...:..:::  |..
Mouse    72 GEDSSKNVFFSSSSMFSSLALILMGANGTTASQISQVLSLDKCSNGGADVQQGFQSLLTEVNKTD 136

  Fly   113 LSQKLRLVNEVLMTSAKKYDVTKDVRPS----------KL------------MDEWLSSHLDGVL 155
            ....||..|::.  |...:|:.:..:.|          ||            ::.|::.....|:
Mouse   137 TGHMLRRANKIF--SDNNFDIMESFKESCYKLYRVEIEKLDFKGTPEQCRQHINAWVAKKTKDVI 199

  Fly   156 ANFVQEKKLNAGENIVAISGMTVTPLWASHFQSEINRYFVNNPGTGYASKDPTCVPMMHSLSSFE 220
            ...:....:|:...::.::.......|...|..|..|.....    .:..:...|.||...|:|:
Mouse   200 RELLSLYTVNSNTRLILVNATYFKGKWEKQFNKEDTREMPFK----VSKNEKKTVQMMSKKSTFK 260

  Fly   221 TMSTDEAKG--IYIPFSSANLGMLILLPRKGVTCKDILDNLNNQIN----VEYN-----DHKDVH 274
            |...:|...  :::|::...|.|:|:||.:.|.    |..:.|||:    :::.     :.::|.
Mouse   261 TYYAEEISTTIVFLPYTDKELSMIIMLPDEQVE----LSMVENQISYKKLIQWTRLVKMEEEEVQ 321

  Fly   275 LLLPIFKEKFDYNIAKFFNGINIEDTFKDSAFKSKAKIKINNFRVNHGIRFQPILRLEVVDDIDT 339
            :.||.||.:..|::......:.:.|.|::|      :...:......|:....::....|:..:.
Mouse   322 VFLPRFKLEATYDMKDVLCKLGMTDAFEES------RADFSGISSKKGLFLSNVVHKSFVEVNEE 380

  Fly   340 G-----KTETFEV-----------NRPFVFVIK-DKI-NVYAVGRIEN 369
            |     .||...|           :|||:|:|: ||. .:..:||..:
Mouse   381 GTEAAVATEIVTVGSPLTQRCLIADRPFLFLIQGDKSKEILFLGRFSS 428

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp76ANP_524153.1 SERPIN 22..367 CDD:294093 78/419 (19%)
Serpinb6eNP_001039000.2 serpin 53..429 CDD:393296 72/392 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.