DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp76A and Spn77Bb

DIOPT Version :9

Sequence 1:NP_524153.1 Gene:Acp76A / 40078 FlyBaseID:FBgn0015586 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_649206.1 Gene:Spn77Bb / 40235 FlyBaseID:FBgn0036969 Length:362 Species:Drosophila melanogaster


Alignment Length:245 Identity:59/245 - (24%)
Similarity:98/245 - (40%) Gaps:69/245 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   171 VAISGMTVT---PLWASHF---QSEINRYFVNNPGTGYASKDPTCVPMMHSLSSFETMSTDEAKG 229
            |.:.|:||:   ..|...|   |:::.:::  |.|...|.|    |.||.....:..:  :..||
  Fly   140 VTVLGITVSYFKAKWKYPFDKSQTKVEQFY--NDGGSPAGK----VEMMVQTGKYAYV--NNVKG 196

  Fly   230 IY-----IPFSSANLGMLILLPRKGVTCKDILDNLNN--------QINVEYNDHKDVHLLLPIFK 281
            :.     :||....|.|::|||:.......:|..|.|        ::....|: .||.:.||   
  Fly   197 LQADVLELPFGEHELVMIVLLPKSSQGVNLVLYQLKNLGLHRLLEKLEASKNE-TDVEVKLP--- 257

  Fly   282 EKFDYNIAKFFNGINIEDTFKDSA-------FKSKAKIKINNFRVNHG----IRFQPILRLEVVD 335
             |||..     :.:::|||..|:.       |....|:.|   .:.|.    ..:....|: |||
  Fly   258 -KFDTR-----SVLSLEDTVYDAGLTDLRNDFADLDKLLI---AIGHRGACLTLYHQFARI-VVD 312

  Fly   336 D---------IDTGKTE-TFEVNRPFVFVI---KDKI----NVYAVGRIE 368
            :         ..:||.. .|.|||||.:::   |.|:    .|:..|.|:
  Fly   313 EEGLPNAVPQKSSGKNNIKFHVNRPFAYLVLQKKHKLLIHSGVFREGEIQ 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp76ANP_524153.1 SERPIN 22..367 CDD:294093 58/242 (24%)
Spn77BbNP_649206.1 SERPIN 13..356 CDD:238101 56/237 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11461
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.